@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : ACVR1_HUMAN: (2014-10-16 )
MVDGVMILPVLIMIALPSPSMEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVGLIILSVVFAVCLLACLLGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC

Atome Classification :

(27 SA) .........10........20........30........40........50........60........70........80........90........100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280.......290.......300.......310.......320......---.330.......340.......350.......360.......370.......380.......390.......400.......410.-....-..420.......430.......440.......450.......460.......470.......480.......490.......500.......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MVDGVMILPVLIMIALPSPSMEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVGLIILSVVFAVCLLACLLGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQG---KPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWE-VARR-MVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC
1 PsiBlast_PDB 95.0899%-113 - C1 -3H9R ACVR1_HUMAN A:[3-330] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------TTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTS---STQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQG---KPAIAHRDLKSKNILVKKNGQCCIADLGLAVMH-------------RVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWE-VARR-MVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKID----------
25 PsiBlast_CBE 90.8899%-107 - C1 -3Q4U ACVR1_HUMAN C:[6-301] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------VARDITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQG---KPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWE-VARR-MVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKID----------
22 PsiBlast_CBE 90.8299%-110 - C1 -4BGG ACVR1_HUMAN C:[6-299] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------VARDITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEI----G---KPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTN---VGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWE-VAR---------EDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTK------------
3 PsiBlast_PDB 90.4799%-107 - C1 -3OOM ACVR1_HUMAN A:[5-301] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TVARDITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQG---KPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWE-VARR-MVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKID----------
26 PsiBlast_CBE 89.9999%-111 - C1 -3Q4U ACVR1_HUMAN B:[2-300] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MQRTVARDITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQG---KPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWE-VARR-MVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKI-----------
2 PsiBlast_PDB 89.9399%-107 - C1 -3MTF ACVR1_HUMAN A:[5-300] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TVARDITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQG---KPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWE-VARR-MVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKI-----------
6 PsiBlast_PDB 89.6199%-109 - C1 -4DYM ACVR1_HUMAN A:[9-301] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQG---KPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWE-VARR-MVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKID----------
21 PsiBlast_CBE 89.4599%-109 - C1 -4BGG ACVR1_HUMAN D:[6-300] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------VARDITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMT------QLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFG------KPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWE-VARR-MVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKI-----------
5 PsiBlast_PDB 89.3499%-108 - C1 -4BGG ACVR1_HUMAN A:[5-300] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TVARDITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQG---KPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWE-VARR-MVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKI-----------
4 PsiBlast_PDB 89.1699%-109 - C1 -3Q4U ACVR1_HUMAN A:[4-301] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RTVARDITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQG---KPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWE-VARR-MVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKID----------
23 PsiBlast_CBE 89.0699%-109 - C1 -4BGG ACVR1_HUMAN B:[5-300] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TVARDITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFG------KPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWE-VARR-MVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKI-----------
15 PsiBlast_PDB 84.6566%-109 - C1 -2WOU TGFR1_HUMAN A:[3-298] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEIVGTQG---KPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWE-IARR-CSIGGIHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLTALRIKKTLSQL-----------
14 PsiBlast_PDB 84.1866%-107 - C1 -2WOT TGFR1_HUMAN A:[3-298] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEIVGTQG---KPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWE-IARR-CSIGGIHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLTALRIKKTLSQL-----------
17 PsiBlast_PDB 84.0966%-106 - C1 -3GXL TGFR1_HUMAN A:[1-295] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------IARTIVLQESIGKGRFGEVWRGKW---EVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEIVGTQG---KPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDTID-----RVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWE-IARR-CSI---HEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNR--SCEALRVMAKIMRECWYANGAARLTALRIKKTLSQL-----------
13 PsiBlast_PDB 84.0766%-106 - C1 -3TZM TGFR1_HUMAN A:[6-301] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEIVGTQG---KPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDTIDIAP--RVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWE-IARR-CSIGGIHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLTALRIKKTLSQL-----------
82 HHSearch 83.4165%-106 - C1 -3HMM TGFR1_HUMAN A:[1-298] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------IARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEIVGTQG---KPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDTIDIA-----GTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWE-IARR-CSIGGIHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLTALRIKKTLSQLSQQ--------
16 PsiBlast_PDB 81.9666%-107 - C1 -1RW8 TGFR1_HUMAN A:[1-296] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEIVGTQG---KPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWE-IARR-CSIGGIHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLTALRIKKTLSQL-----------
12 PsiBlast_PDB 81.5864%-101 - C1 -3MDY BMR1B_HUMAN A:[10-334] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SLRDLIEQSQSSGSGSGLPLLVQRTIAKQIQMVKQIGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDYLKSTTLDAKSMLKLAYSSVSGLCHLHTEIFSTQG---KPAIAHRDLKSKNILVKKNGTCCIADLGLAVKFI---------PNTRVGTKRYMPPEVLDESLNRNHFQSYIMADMYSFGLILWE-VARR-CVSGGIVEEYQLPYHDLVPSDPSYEDMREIVCIKKLRPSFPNRWSSDECLRQMGKLMTECWAHNPASRLTALRVKKTLAKMSESQD------
65 PsiBlast_CBE 81.1164%-102 - C1 -3MDY BMR1B_HUMAN C:[10-334] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SLRDLIEQSQSSGSGSGLPLLVQRTIAKQIQMVKQIGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDYLKSTTLDAKSMLKLAYSSVSGLCHLHTEIFSTQG---KPAIAHRDLKSKNILVKKNGTCCIADLGLAVKFI-------IPPNTRVGTKRYMPPEVLDESLNRNHFQSYIMADMYSFGLILWE-VARR-CVSGGIVEEYQLPYHDLVPSDPSYEDMREIVCIKKLRPSFPNRWSSDECLRQMGKLMTECWAHNPASRLTALRVKKTLAKMSESQD------
8 PsiBlast_PDB 78.9866%-102 - C1 -1PY5 TGFR1_HUMAN A:[26-321] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEIVGTQG---KPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWE-IARR-CSIGGIHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLTALRIKKTLSQL-----------
19 PsiBlast_PDB 73.4140%-101 - C1 -3Q4T AVR2A_HUMAN A:[26-316] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LQLLEVKARGRFGCVWKAQLLNEYVAVKIFPIQDKQSWQNEYEVYSLPGMKHENILQFIGAEKRGTSVDVDLWLITAFHEKGSLSDFLKANVVSWNELCHIAETMARGLAYLHEDIPGLKDGH-KPAISHRDIKSKNVLLKNNLTACIADFGLALKFEAGKSAGDT--HGQVGTRRYMAPEVLEGAINFQ-RDAFLRIDMYAMGLVLWE-LASRCTAADGPVDEYMLPFEEEIGQHPSLEDMQEVVVHKKKRPVLRDYWQKHAGMAMLCETIEECWDHDAEARLSAGCVGERITQM-----------
66 PsiBlast_CBE 73.2240% -99 - C1 -4ASX AVR2A_HUMAN B:[26-316] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LQLLEVKARGRFGCVWKAQLLNEYVAVKIFPIQDKQSWQNEYEVYSLPGMKHENILQFIGAEKRGTSVDVDLWLITAFHEKGSLSDFLKANVVSWNELCHIAETMARGLAYLHEDIPGLKDGH-KPAISHRDIKSKNVLLKNNLTACIADFGLALKFEAGKSAGDT--HGQVGTRRYMAPEVLEGAINFQ-RDAFLRIDMYAMGLVLWE-LASRCTAADGPVDEYMLPFEEEIGQHPSLEDMQEVVVHKKKRPVLRDYWQKHAGMAMLCETIEECWDHDAEARLSAGCVGERITQM-----------
68 PsiBlast_CBE 72.8040%-100 - C1 -3SOC AVR2A_HUMAN B:[26-316] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LQLLEVKARGRFGCVWKAQLLNEYVAVKIFPIQDKQSWQNEYEVYSLPGMKHENILQFIGAEKRGTSVDVDLWLITAFHEKGSLSDFLKANVVSWNELCHIAETMARGLAYLHEDIPGLKDGH-KPAISHRDIKSKNVLLKNNLTACIADFGLALKFEAGKSA--T--HGQVGTRRYMAPEVLEGAINFQ-RDAFLRIDMYAMGLVLWE-LASRCTAADGPVDEYMLPFEEEIGQHPSLEDMQEVVVHKKKRPVLRDYWQKHAGMAMLCETIEECWDHDAEARLSAGCVGERITQM-----------