@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : KAPCA_HUMAN: (2013-07-21 )
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF

Atome Classification :

(98 SA) .........10........20........30........40........50..-......60...---..-...70........80..-......90....-..--..-100.......110...-....120.......130....-...140.......150.......160........170..---..-...180.......190--.----.--......200.......210..---.....220.......230....-...240---..--.....250..------.....260--.........270.......280...-.-...290.......300---.......310.......320.......330-......---..340.......350
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTG-SFGRVMLVKHK---ET-GNHYAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYVPGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLL---ID-QQGYIQVTDFGFAKR---V----K--GRTWTLCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-NGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIR---VSINEKCGKEFSEF
11 PsiBlast_PDB 94.1099%-101 - C1 -3OWP KAPCA_HUMAN A:[16-351] ---------------VKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTG-SFGRVMLVKHK---ET-GNHYAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYVPGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLL---ID-QQGYIQVTDFGFAKR---V----K--GRTWTLCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-NGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIR---VSINEKCGKEFSEF
12 PsiBlast_PDB 93.9399%-102 - C1 -3OXT KAPCA_HUMAN A:[15-351] --------------SVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTG-SFGRVMLVKHK---ET-GNHYAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYVPGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLL---ID-QQGYIQVTDFGFAKR---V----K--GRTWTLCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-NGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIR---VSINEKCGKEFSEF
13 PsiBlast_PDB 93.8599%-101 - C1 -3P0M KAPCA_HUMAN A:[15-351] --------------SVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTG-SFGRVMLVKHK---ET-GNHYAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYVPGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLL---ID-QQGYIQVTDFGFAKR---V----K--GRTWTLCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-NGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIR---VSINEKCGKEFSEF
10 PsiBlast_PDB 93.8199%-101 - C1 -3OVV KAPCA_HUMAN A:[15-351] --------------SVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTG-SFGRVMLVKHK---ET-GNHYAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYVPGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLL---ID-QQGYIQVTDFGFAKR---V----K--GRTWTLCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-NGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIR---VSINEKCGKEFSEF
16 PsiBlast_PDB 93.7799% -95 - C1 -3VQH KAPCA_HUMAN A:[5-351] ----AAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTG-SFGRVMLVKHK---ET-GNHYAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYVPGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLL---ID-QQGYIQVTDFGFAKR---V----K--GRTWTLCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-NGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIR---VSINEKCGKEFSEF
19 PsiBlast_PDB 93.4798%-102 - C1 -2VO7 KAPCA_BOVIN A:[15-351] --------------SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTG-SFGRVMLVKHM---ET-GNHYAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYVPGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLL---ID-QQGYIQVTDFGFAKR---V----K--GRTWTLCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-NGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIR---VSINEKCGKEFSEF
3 PsiBlast_PDB 93.4299%-107 - C1 -2F7Z KAPCA_BOVIN E:[16-351] ---------------VKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTG-SFGRVMLVKHM---ET-GNHYAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYVPGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLL---ID-QQGYIQVTDFGFAKR---V----K--GRTWTLCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-NGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIR---VSINEKCGKEFSEF
18 PsiBlast_PDB 93.3998%-103 - C1 -2C1B KAPCA_BOVIN A:[15-351] --------------SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTG-SFGRVMLVKHM---ET-GNHYAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYVPGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLL---ID-QQGYIQVTDFGFAKR---V----K--GRTWTLCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-NGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIR---VSINEKCGKEFSEF
14 PsiBlast_PDB 93.2499%-102 - C1 -3POO KAPCA_HUMAN A:[15-351] --------------SVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTG-SFGRVMLVKHK---ET-GNHYAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYVPGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLL---ID-QQGYIQVTDFGFAKR---V----K--GRTWTLCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-NGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKF----DTSNFDD-Y-EEEEIR---VSINEKCGKEFSEF
5 PsiBlast_PDB 93.0299%-102 - C1 -2OJF KAPCA_BOVIN E:[16-351] ---------------VKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTG-SFGRVMLVKHM---ET-GNHYAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYVPGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLL---ID-QQGYIQVTDFGFAKR---V----K--GRTWTLCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-NGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIR---VSINEKCGKEFSEF
7 PsiBlast_PDB 92.9599%-100 - C1 -3AGM KAPCA_HUMAN A:[13-351] ------------QESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTG-SFGRVMLVKHK---ET-GNHYAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYVPGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLL---ID-QQGYIQVTDFGFAKR---V----K--GRTWTLCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-NGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIR---VSINEKCGKEFSEF
9 PsiBlast_PDB 92.8999%-101 - C1 -3OOG KAPCA_HUMAN A:[17-351] ----------------KEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTG-SFGRVMLVKHK---ET-GNHYAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYVPGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLL---ID-QQGYIQVTDFGFAKR---V----K--GRTWTLCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-NGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIR---VSINEKCGKEFSEF
8 PsiBlast_PDB 92.8899%-100 - C1 -3L9L KAPCA_HUMAN A:[12-351] -----------EQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTG-SFGRVMLVKHK---ET-GNHYAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYVPGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLL---ID-QQGYIQVTDFGFAKR---V----K--GRTWTLCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-NGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIR---VSINEKCGKEFSEF
17 PsiBlast_PDB 92.7598%-102 - C1 -2C1A KAPCA_BOVIN A:[15-351] --------------SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTG-SFGRVMLVKHM---ET-GNHYAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYVPGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLL---ID-QQGYIQVTDFGFAKR---V----K--GRTWTLCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-NGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIR---VSINEKCGKEFSEF
2 PsiBlast_PDB 92.6699%-100 - C1 -2F7X KAPCA_BOVIN E:[16-351] ---------------VKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTG-SFGRVMLVKHM---ET-GNHYAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYVPGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLL---ID-QQGYIQVTDFGFAKR---V----K--GRTWTLCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-NGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIR---VSINEKCGKEFSEF
1 PsiBlast_PDB 92.4099%-102 - C1 -2F7E KAPCA_BOVIN E:[16-351] ---------------VKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTG-SFGRVMLVKHM---ET-GNHYAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYVPGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLL---ID-QQGYIQVTDFGFAKR---V----K--GRTWTLCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-NGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIR---VSINEKCGKEFSEF
15 PsiBlast_PDB 92.0599% -96 - C1 -3AGL KAPCA_HUMAN A:[11-351] ----------SEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTG-SFGRVMLVKHK---ET-GNHYAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYVPGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLL---ID-QQGYIQVTDFGFAKR---V----K--GRTWTLCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-NGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIR---VSINEKCGKEFSEF
4 PsiBlast_PDB 92.0599%-103 - C1 -2OH0 KAPCA_BOVIN E:[16-351] ---------------VKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTG-SFGRVMLVKHM---ET-GNHYAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYVPGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLL---ID-QQGYIQVTDFGFAKR---V----K--GRTWTLCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-NGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIR---VSINEKCGKEFSEF
6 PsiBlast_PDB 90.8499% -97 - C1 -3MVJ KAPCA_HUMAN A:[36-371] ---------------VKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTG-SFGRVMLVKHK---ET-GNHYAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYVPGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLL---ID-QQGYIQVTDFGFAKR---V----K--GRTWTLCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-NGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIR---VSINEKCGKEFSEF
111 Fugue 82.1990% -99 - C1 -1CDK KAPCA_PIG A:[8-350] KGSEQESVKEFLAKAKEDFLKKWENPAQNTA------H--LDQFERIKTLGT-GSFGRVMLVKHK---ETG-NHFAMKILDKQKVVK-LKQIEHTLNEKRI-LQAV---NFPFLVKLEYSFKDN-SNLYMVMEYVPGGEMFSHLRR-IGRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLL---IDQ-QGYIQVTDFGFAKR---VKGRT------WTLCGTPEYLAPEIILS-KGY--NKAVDWWALGVLIYEMAAG-YPPFFAD-----QPIQIYEKIVSGKVRFPS----------HFSSDLKDLLRNLLQVDLTKRFGNL-K-DGVNDIKNHKWFA---TTDWIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIRVSI---NEKCGKEFSEF
26 PsiBlast_CBE 72.8698% -59 - C1 -1CDK KAPCA_PIG B:[8-350] --------KGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTG-SFGRVMLVKHK---ET-GNHFAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEYSFKDNS-NLYMVMEYVPGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLL---ID-QQGYIQVTDFGFAKR---V----K--GRTW-LCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-DGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIR---VSINEKCGKEFSEF
63 PsiBlast_CBE 71.4597% -55 - C1 -1SMH KAPCA_BOVIN A:[1-350] -GNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTG-SFGRVMLVKHM---ET-GNHYAMKILDKQKVVKL-KEIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYAPGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLM---ID-QQGYIQVTDFGLAKR---V----K--GRTW-LCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-NGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIR---V-INEKCGKEFSEF
77 PsiBlast_CBE 70.3097% -60 - C1 -1FMO KAPCA_MOUSE E:[13-350] -------------ESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTG-SFGRVMLVKHK---ES-GNHYAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYVAGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLL---ID-QQGYIQVTDFGFAKR---V----K--GRTW-LCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-NGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIR---V-INEKCGKEFTEF
62 PsiBlast_CBE 70.1597% -53 - C1 -1XHA KAPCA_BOVIN A:[1-350] -GNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTG-SFGRVMLVKHM---ET-GNHYAMKILDKQKVVKL-KEIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYAPGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLM---ID-QQGYIQVTDFGLAKR---V----K--GRTW-LCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-NGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIR---V-INEKCGKEFSEF
89 PsiBlast_CBE 70.1097% -53 - C1 -3QAM KAPCA_MOUSE E:[1-350] -GNAAAAKKGSEQESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTG-SFGRVMLVKHK---ES-GNHYAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYVAGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLL---ID-QQGYIQVTDFGFAKR---V----K--GRTW-LCGTPEYLAPAIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-NGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIR---V-INEKCGKEFTEF
40 PsiBlast_CBE 69.8898% -60 - C1 -3DNE KAPCA_BOVIN A:[13-350] -------------ESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTG-SFGRVMLVKHM---ET-GNHYAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYVPGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLL---ID-QQGYIQVTDFGFAKR---V----K--GRTW-LCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-DGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIR---V-INEKCGKEFSEF
35 PsiBlast_CBE 69.8498% -59 - C1 -1XH8 KAPCA_BOVIN A:[12-350] ------------QESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTG-SFGRVMLVKHM---ET-GNHYAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYVPGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLL---ID-QQGYIQVTDFGFAKR---V----K--GRTW-LCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-NGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIR---V-INEKCGKEFSEF
29 PsiBlast_CBE 69.7198% -60 - C1 -3ZO4 KAPCA_BOVIN A:[15-351] --------------SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTG-SFGRVMLVKHM---ET-GNHYAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYVPGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLL---ID-QQGYIQVTDFGFAKR---V----K--GRTW-LCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-NGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIR---V-INEKCGKEFSEF
65 PsiBlast_CBE 69.6297% -57 - C1 -2GNF KAPCA_BOVIN A:[10-350] ----------SEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTIGTG-SFGRVMLVKHM---ET-GNHYAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYMPGGDMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLL---ID-QQGYIKVADFGFAKR---V----K--GRTW-LCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-NGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIR---V-INEKCGKEFSEF
101 PsiBlast_CBE 69.4797% -56 - C1 -3QAL KAPCA_MOUSE E:[1-350] -GNAA---------SVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTG-SFGRVMLVKHK---ES-GNHYAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYVAGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLL---ID-QQGYIQVTDFGFAKR---V----K--GRTW-LCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKAFGNL-K-NGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIR---V-INEKCGKEFTEF
37 PsiBlast_CBE 69.4598% -58 - C1 -1XH5 KAPCA_BOVIN A:[14-350] --------------SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTG-SFGRVMLVKHM---ET-GNHYAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYVPGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLL---ID-QQGYIQVTDFGFAKR---V----K--GRTW-LCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-NGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIR---V-INEKCGKEFSEF
30 PsiBlast_CBE 69.3798% -65 - C1 -3L9N KAPCA_HUMAN A:[15-351] --------------SVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTG-SFGRVMLVKHK---ET-GNHYAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYAPGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLM---ID-QQGYIKVTDFGFAKR---V----K--GRTW-LCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-NGVNDIKNHKWFATTD---WIAIYQRKVEAPFIP---GPGDTSNFDD-Y-EEEEIR---V-INEKCGKEFSEF
75 PsiBlast_CBE 69.3397% -61 - C1 -1RE8 KAPCA_MOUSE A:[12-350] ------------QESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTG-SFGRVMLVKHK---ES-GNHYAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYVAGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLL---ID-QQGYIQVTDFGFAKR---V----K--GRTW-LCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-NGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIR---V-INEKCGKEFTEF
53 PsiBlast_CBE 69.1798% -57 - C1 -2GNL KAPCA_BOVIN A:[11-350] -----------EQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTIGTG-SFGRVMLVKHM---ET-GNHYAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYVPGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLL---ID-QQGYIKVADFGFAKR---V----K--GRTW-LCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-NGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIR---V-INEKCGKEFSEF
70 PsiBlast_CBE 69.1297% -55 - C1 -3IDC KAPCA_MOUSE A:[8-350] --------KGSEQESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTG-SFGRVMLVKHK---ES-GNHYAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYVAGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLL---ID-QQGYIQVTDFGFAKR---V----K--GRTW-LCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-NGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIR---V-INEKCGKEFTEF
23 PsiBlast_CBE 69.1299% -60 - C1 -3MVJ KAPCA_HUMAN E:[36-371] ---------------VKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTG-SFGRVMLVKHK---ET-GNHYAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYVPGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLL---ID-QQGYIQVTDFGFAKR---V----K--GRTW-LCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-NGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIR---V-INEKCGKEFSEF
71 PsiBlast_CBE 69.0997% -55 - C1 -3IDB KAPCA_MOUSE A:[8-350] --------KGSEQESVKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTG-SFGRVMLVKHK---ES-GNHYAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYVAGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLL---ID-QQGYIQVTDFGFAKR---V----K--GRTW-LCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-NGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIR---V-INEKCGKEFTEF
33 PsiBlast_CBE 69.0298% -59 - C1 -4IJ9 KAPCA_BOVIN A:[14-350] --------------SVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTG-SFGRVMLVKHM---ET-GNHYAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYVPGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLL---ID-QQGYIQVTDFGFAKR---V----K--GRTW-LCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-NGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIR---V-INEKCGKEFSEF
68 PsiBlast_CBE 68.8997% -61 - C1 -3OW3 KAPCA_MOUSE A:[15-350] ---------------VKEFLAKAKEDFLKKWETPSQNTAQLDQFDRIKTLGTG-SFGRVMLVKHK---ES-GNHYAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYVAGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLL---ID-QQGYIQVTDFGFAKR---V----K--GRTW-LCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-NGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIR---V-INEKCGKEFTEF
22 PsiBlast_CBE 68.8699% -59 - C1 -3L9L KAPCA_HUMAN B:[13-351] ------------QESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTG-SFGRVMLVKHK---ET-GNHYAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYVPGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDLIYRDLKPENLL---ID-QQGYIQVTDFGFAKR---V----K--GRTW-LCGTPEYLAPEIILSK---GYNKAVDWWALGVLIYEMAAGY-PPFFAD---QP--IQIYEKIVSG------KVRFPS----HFSSDLKDLLRNLLQVDLTKRFGNL-K-NGVNDIKNHKWFATTD---WIAIYQRKVEAPFIPKFKGPGDTSNFDD-Y-EEEEIR---V-INEKCGKEFSEF
41 PsiBlast_CBE 68.7798% -59 - C1 -3DND KAPCA_BOVIN A:[15-350] ---------------VKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTG-SFGRVMLVKHM---ET-GNHYAMKILDKQKVVKL-KQIEHTLNEKRI-LQ--AV-NFPFLVKLEFSFKDNS-NLYMVMEYVPGGEMFSHLRRI-GRFSEPHARFYAAQIVLTFEYLHS-LDL