@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : MELK_HUMAN: (2013-07-23 )
MKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKNTLGSDLPRIKTEIEALKNLRHQHICQLYHVLETANKIFMVLEYCPGGELFDYIISQDRLSEEETRVVFRQIVSAVAYVHSQGYAHRDLKPENLLFDEYHKLKLIDFGLCAKPKGNKDYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPFDDDNVMALYKKIMRGKYDVPKWLSPSSILLLQQMLQVDPKKRISMKNLLNHPWIMQDYNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLLLAKKARGKPVRLRLSSFSCGQASATPFTDIKSNNWSLEDVTASDKNYVAGLIDYDWCEDDLSTGAATPRTSQFTKYWTESNGVESKSLTPALCRTPANKLKNKENVYTPKSAVKNEEYFMFPEPKTPVNKNQHKREILTTPNRYTTPSKARNQCLKETPIKIPVNSTGTDKLMTGVISPERRCRSVELDLNQAHMEETPKRKGAKVFGSLERGLDKVITVLTRSKRKGSARDGPRRLKLHYNVTTTRLVNPDQLLNEIMSILPKKHVDFVQKGYTLKCQTQSDFGKVTMQFELEVCQLQKPDVVGIRRQRLKGDAWVYKRLVEDILSSCKV

Atome Classification :

(72 SA) .........10........20........30........40....--..--.--.--50........60...-.....70........80........90........100.-......110.......120...-....130.......140-...---..---....150......-.160.......170.......180.......190.......200.......-210........220...--.--..-------------------.230----------.--........240.......250.-----.------.....260....---...270.......280.......290.......300.......310.......320.......330.......340.......350.......360.......370.......380.......390.......400.......410.......420.......430.......440.......450.......460.......470.......480.......490.......500.......510.......520.......530.......540.......550.......560.......570.......580.......590.......600.......610.......620.......630.......640.......650
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MKDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKN--TL--G--S--DLPRIKTEIEALKNL-RHQHICQLYHVLETANKIFMVLEYCPGGELFDYIISQDR-LSEEETRVVFRQIVSAVAYVHS-QGYAHRDLKPENLLF---DEY---HK---LKLIDFGLCAKPK-GNKDYHLQTCCGSLAYAAPELIQGKSYLGSEADVWSMGILLYVLMCGFLPF-DD-DNVMALYKKIMRGK--Y--DV-------------------PK------------W--LSPSSILLLQQMLQVDPKKRIS-----M------KNLLNHPWIMQD---YNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLLLAKKARGKPVRLRLSSFSCGQASATPFTDIKSNNWSLEDVTASDKNYVAGLIDYDWCEDDLSTGAATPRTSQFTKYWTESNGVESKSLTPALCRTPANKLKNKENVYTPKSAVKNEEYFMFPEPKTPVNKNQHKREILTTPNRYTTPSKARNQCLKETPIKIPVNSTGTDKLMTGVISPERRCRSVELDLNQAHMEETPKRKGAKVFGSLERGLDKVITVLTRSKRKGSARDGPRRLKLHYNVTTTRLVNPDQLLNEIMSILPKKHVDFVQKGYTLKCQTQSDFGKVTMQFELEVCQLQKPDVVGIRRQRLKGDAWVYKRLVEDILSSCKV
1 PsiBlast_PDB 96.0299%-129 - C1 -4BL1 MELK_HUMAN A:[3-334] -KDYDELLKYYELHETIGTGGFAKVKLACHILTGEMVAIKIMDKN--TL---------LPRIKTEIEALKNL-RHQHICQLYHVLETANKIFMVLEYCPGGELFDYIISQDR-LSEEETRVVFRQIVSAVAYVHS-QGYAHRDLKPENLLF---DEY---HK---LKLIDFGLCAK---------------SLAYAAPELIQGK---GSEADVWSMGILLYVLMCGFLPF-DD-DNVMALYKKIMRGK--Y--DV-------------------PK------------W--LSPSSILLLQQMLQVDPKKRIS-----M------KNLLNHPWIMQD---YNYPVEWQSKNPFIHLDDDCVTELSVHHRNNRQTMEDLISLWQYDHLTATYLLLLAKKARGKPVRLR------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
50 PsiBlast_CBE 69.0934%-126 - C1 -3BHH KCC2B_HUMAN A:[6-266] ----------YQLYEDIG----SVVRRCVKLCTGHEYAAKIINTK--KL--S--AR-DHQKLEREARICRLL-KHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREY-YSEADASHCIQQILEAVLHCHQ-MGVVHRDLKPENLLL---ASK---CKGAAVKLADFGLAIEVQ-GDQQAWFGF-AGTPGYLSPEVLRKEAY-GKPVDIWACGVILYILLVGYPPF-WD-EDQHKLYQQIKAGA--Y--DFPS-----------------PE------------WDTVTPEAKNLINQMLTINPAKRIT-----A------HEALKHPWVCQ-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
49 PsiBlast_CBE 68.9534%-126 - C1 -3BHH KCC2B_HUMAN B:[6-266] ----------YQLYEDIGK---SVVRRCVKLCTGHEYAAKIINTK--KL--S--AR-DHQKLEREARICRLL-KHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREY-YSEADASHCIQQILEAVLHCHQ-MGVVHRDLKPENLLL---ASK---CKGAAVKLADFGLAIEVQ-GDQQAWFGF-AGTPGYLSPEVLRKEAY-GKPVDIWACGVILYILLVGYPPF-WD-EDQHKLYQQIKAGA--Y--DFPS-----------------PE------------WDTVTPEAKNLINQMLTINPAKRIT-----A------HEALKHPWVCQ-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
66 PsiBlast_CBE 68.1534%-121 - C1 -2WEL KCC2D_HUMAN A:[6-266] ----------YQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTK--KL--S--AR-DHQKLEREARICRLL-KHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREY-YSEADASHCIQQILESVNHCHL-NGIVHRDLKPENLLL---ASK---SKGAAVKLADFGLAIEVQ-GDQQAWF-GFAGTPGYLSPEVLRKDPY-GKPVDMWACGVILYILLVGYPPF-WD-EDQHRLYQQIKAGA--Y--DFPS-----------------PE------------WDTVTPEAKDLINKMLTINPAKRIT-----A------SEALKHPWICQ-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
2 PsiBlast_PDB 66.9246%-113 - C1 -2Y94 AAPK1_RAT A:[15-298] -------IGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQ--KI--R--SLDVVGKIRREIQNLKLF-RHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGR-LDEKESRRLFQQILSGVDYCHR-HMVVHRDLKPENVLL---DAH---MN---AKIADFGLSNMMS-DGE--FLRTSCGSPNYAAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPF-DD-DHVPTLFKKICDGI--F--YT-------------------PQ------------Y--LNPSVISLLKHMLQVDPMKRAT-----I------KDIREHEWFKQDLPKYLFPEDPSYSSTMI--DDEALKEV-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
34 PsiBlast_CBE 66.6636%-126 - C1 -3HX4 ? A:[52-309] ----------YKGQRVLGKGSFGEVILCKDKITGQECAVKVISK-------------DKESLLREVQLLKQL-DHPNIMKLYEFFEDKGYFYLVGEVYTGGELFDEIISRKR-FSEVDAARIIRQVLSGITYMHK-NKIVHRDLKPENLLL---ESK---SKDANIRIIDFGLSTHFE-ASK--KMKDKIGTAYYIAPEVLHGT--YDEKCDVWSTGVILYILLSGCPPF-NG-ANEYDILKKVEKGK--YTFEL-------------------PQ------------WKKVSESAKDLIRKMLTYVPSMRIS-----A------RDALDHEWI-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
29 PsiBlast_CBE 66.2734%-118 - C1 -4FG7 KCC1A_HUMAN A:[11-277] -KQAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIA-----------------SMENEIAVLHKI-KHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGF-YTERDASRLIFQVLDAVKYLHD-LGIVHRDLKPENLLYYSLDED---SK---IMISDFGLSKMED-PG----------TPGYVAPEVLAQK---SKAVDCWSIGVIAYILLCGYPPF-YD-ENDAKLFEQILKAE--YEFDS-------------------PY------------WDDISDSAKDFIRHLMEKDPEKRFT-----C------EQALQHPWIA------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
51 PsiBlast_CBE 65.1435%-130 - C1 -3LIJ ? A:[35-295] ------LSEMYQRVKKLGS---GEVLLCRDKVTHVERAIKIIRK----------S--SNSKLLEEVAVLKLL-DHPNIMKLYDFFEDKRNYYLVMECYKGGELFDEIIHRMK-FNEVDAAVIIKQVLSGVTYLHK-HNIVHRDLKPENLLL---ESK---EKDALIKIVDFGLSAVFE-NQK--KMKERLGTAYYIAPEVLRKK--YDEKCDVWSIGVILFILLAGYPPF-GG-QTDQEILRKVEKGK--YTFDS-------------------PE------------WKNVSEGAKDLIKQMLQFDSQRRIS-----A------QQALEHPWI-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
123 HHSearch 64.8734%-125 - C1 -4GV1 AKT1_HUMAN A:[7-269] -------MNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKE--VI--VAKD--EVAHTLTENRVLQNS-RHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERV-FSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLML---DKD---GH---IKITDFGLCKEGI-KD-GATMKTFCGTPEYLAPEVLEDNDY-GRAVDWWGLGVVMYEMMCGRLPF-YN-QDHEKLFELILMEE--I--RF-------------------PR------------T--LGPEAKSLLSGLLKKDPKQRLGGGSEDA------KEIMQHRFFA------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
15 PsiBlast_PDB 64.3247%-117 - C1 -3AQV AAPK2_HUMAN A:[10-275] -------IGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQ--KI--R--SLDVVGKIKREIQNLKLF-RHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGR-VEEMEARRLFQQILSAVDYCHR-HMVVHRDLKPENVLL---DAH---MN---AKIADFGLSNMMS-DGE--FL------PNYAAPEVISGRLYAGPEVDIWSCGVILYALLCGTLPF-DD-EHVPTLFKKIRGGV--F--YI-------------------PE------------Y--LNRSVATLLMHMLQVDPLKRAT-----I------KDIREHEWFKQDLPSYLFP---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
43 PsiBlast_CBE 64.2136%-124 - C1 -3SX9 ? A:[28-285] ----------YKGQRVLGKGSFGEVILCKDKITGQECAVKVISKR--QV--KQKT--DKESLLREVQLLKQL-DHPNIMKLYEFFEDKGYFYLVGEVYTGGELFDEIISRKR-FSEVDAARIIRQVLSGITYMHK-NKIVHRDLKPENLLL---ESK---SKDANIRIIDFGLSTHFE-ASK--KMKDKIGTAYYIAPEVLHGT--YDEKCDVWSTGVILYILLSGCPPF-NG-ANEYDILKKVEKGK--YTFEL-------------------PQ------------WKKVSESAKDLIRKMLTYVPSMRIS-----A------RDALDHEWI-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
32 PsiBlast_CBE 64.0336%-122 - C1 -3HZT ? A:[6-265] ----------YQRVKKLGSGAYGEVLLCKDKLTGAERAIKIIKKSSVTT--T--S--NSGALLDEVAVLKQL-DHPNIMKLYEFFEDKRNYYLVMEVYRGGELFDEIILRQK-FSEVDAAVIMKQVLSGTTYLHK-HNIVHRDLKPENLLL---ESK---SRDALIKIVDFGLSAHFEVG-----------TAYYIAPEVLRKK--YDEKCDVWSCGVILYILLCGYPPF-GG-QTDQEILKRVEKGKFSF--DP-------------------PD------------WTQVSDEAKQLVKLMLTYEPSKRIS-----A------EEALNHPWIVK-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
39 PsiBlast_CBE 63.6236%-124 - C1 -3UPX ? A:[28-285] ----------YKGQRVLGKGSFGEVILCKDKITGQECAVKVISKR--QV--KQKT--DKESLLREVQLLKQL-DHPNIMKLYEFFEDKGYFYLVGEVYTGGELFDEIISRKR-FSEVDAARIIRQVLSGITYMHK-NKIVHRDLKPENLLL---ESK---SKDANIRIIDFGLSTHFE-ASK--KMKDKIGTAYYIAPEVLHGT--YDEKCDVWSTGVILYILLSGCPPF-NG-ANEYDILKKVEKGK--YTFEL-------------------PQ------------WKKVSESAKDLIRKMLTYVPSMRIS-----A------RDALDHEWI-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
41 PsiBlast_CBE 63.2936%-122 - C1 -3T3U ? A:[28-285] ----------YKGQRVLGKGSFGEVILCKDKITGQECAVKVISKR--QV--KQKT--DKESLLREVQLLKQL-DHPNIMKLYEFFEDKGYFYLVGEVYTGGELFDEIISRKR-FSEVDAARIIRQVLSGITYMHK-NKIVHRDLKPENLLL---ESK---SKDANIRIIDFGLSTHFE-ASK--KMKDKIGTAYYIAPEVLHGT--YDEKCDVWSTGVILYILLSGCPPF-NG-ANEYDILKKVEKGK--YTFEL-------------------PQ------------WKKVSESAKDLIRKMLTYVPSMRIS-----A------RDALDHEWI-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
36 PsiBlast_CBE 63.1036%-124 - C1 -3V5P ? A:[28-285] ----------YKGQRVLGKGSFGEVILCKDKITGQECAVKVISKR--QV--KQKT--DKESLLREVQLLKQL-DHPNIMKLYEFFEDKGYFYLVGEVYTGGELFDEIISRKR-FSEVDAARIIRQVLSGITYMHK-NKIVHRDLKPENLLL---ESK---SKDANIRIIDFGLSTHFE-ASK--KMKDKIGTAYYIAPEVLHGT--YDEKCDVWSTGVILYILLSGCPPF-NG-ANEYDILKKVEKGK--YTFEL-------------------PQ------------WKKVSESAKDLIRKMLTYVPSMRIS-----A------RDALDHEWI-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
45 PsiBlast_CBE 62.9736%-121 - C1 -3I7B ? A:[28-285] ----------YKGQRVLGKGSFGEVILCKDKITGQECAVKVISKR--QV--KQKT--DKESLLREVQLLKQL-DHPNIMKLYEFFEDKGYFYLVGEVYTGGELFDEIISRKR-FSEVDAARIIRQVLSGITYMHK-NKIVHRDLKPENLLL---ESK---SKDANIRIIDFGLSTHFE-ASK--KMKDKIGTAYYIAPEVLHGT--YDEKCDVWSTGVILYILLSGCPPF-NG-ANEYDILKKVEKGK--YTFEL-------------------PQ------------WKKVSESAKDLIRKMLTYVPSMRIS-----A------RDALDHEWI-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
27 PsiBlast_CBE 62.8334%-134 - C1 -4FG8 KCC1A_HUMAN B:[14-279] ----EDIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAK-------------------NEIAVLHKI-KHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGF-YTERDASRLIFQVLDAVKYLHD-LGIVHRDLKPENLLYYSLDED---SK---IMISDFG----------GSVLSTACGTPGYVAPEVLAQKPY-SKAVDCWSIGVIAYILLCGYPPF-YD-ENDAKLFEQILKAE--YEFDS-------------------PY------------WDDISDSAKDFIRHLMEKDPEKRFT-----C------EQALQHPWIAGD----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
44 PsiBlast_CBE 62.2336%-119 - C1 -3N51 ? A:[28-285] ----------YKGQRVLGKGSFGEVILCKDKITGQECAVKVISKR--QV--KQKT--DKESLLREVQLLKQL-DHPNIMKLYEFFEDKGYFYLVGEVYTGGELFDEIISRKR-FSEVDAARIIRQVLSGITYMHK-NKIVHRDLKPENLLL---ESK---SKDANIRIIDFGLSTHFE-ASK--KMKDKIGTAYYIAPEVLHGT--YDEKCDVWSTGVILYILLSGCPPF-NG-ANEYDILKKVEKGK--YTFEL-------------------PQ------------WKKVSESAKDLIRKMLTYVPSMRIS-----A------RDALDHEWI-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
55 PsiBlast_CBE 62.0834%-111 - C1 -3TKI CHK1_HUMAN A:[9-278] ----------WDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMK---------------NIKKEICINKML-NHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIG-MPEPDAQRFFHQLMAGVVYLHG-IGITHRDIKPENLLL---DER---DN---LKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTAMLAGELPW-DQPSDSCQEYSDWKEKK--T--YL-------------------NP------------WKKIDSAPLALLHKILVENPSARIT-----I------PDIKKDRW-------YNKPLKKGAKRPRV-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
79 PsiBlast_CBE 61.5334%-111 - C1 -4FSR CHK1_HUMAN A:[8-277] ----------WDLVQTLGEG--GEVQLAVNRVTEEAVAVKIVDMK---------------NIKKEICINKML-NHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIG-MPEPDAQRFFHQLMAGVVYLHG-IGITHRDIKPENLLL---DER---DN---LKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTAMLAGELPW-DQPSDSCQEYSDWKEKK--T--YL-------------------NP------------WKKIDSAPLALLHKILVENPSARIT-----I------PDIKKDRW-------YNKPLKKGAKRPRV-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
77 PsiBlast_CBE 61.3834%-111 - C1 -4FT9 CHK1_HUMAN A:[8-277] ----------WDLVQTLGEG--GEVQLAVNRVTEEAVAVKIVDM---------------ENIKKEICINKML-NHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIG-MPEPDAQRFFHQLMAGVVYLHG-IGITHRDIKPENLLL---DER---DN---LKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTAMLAGELPW-DQPSDSCQEYSDWKEKK--T--YL-------------------NP------------WKKIDSAPLALLHKILVENPSARIT-----I------PDIKKDRW-------YNKPLKKGAKRPRV-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
76 PsiBlast_CBE 61.3134%-108 - C1 -4FTI CHK1_HUMAN A:[8-277] ----------WDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDM---------------ENIKKEICINKML-NHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIG-MPEPDAQRFFHQLMAGVVYLHG-IGITHRDIKPENLLL---DER---DN---LKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTAMLAGELPW-DQPSDSCQEYSDWKEKK--T--YL-------------------NP------------WKKIDSAPLALLHKILVENPSARIT-----I------PDIKKDRW-------YNKPLKKGAKRPRV-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
28 PsiBlast_CBE 61.2634%-138 - C1 -4FG8 KCC1A_HUMAN A:[11-279] -KQAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKE------------------NEIAVLHKI-KHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGF-YTERDASRLIFQVLDAVKYLHD-LGIVHRDLKPENLLYYSLDED---SK---IMISDF--------------------TPGYVAPEVLAQKPY-SKAVDCWSIGVIAYILLCGYPPF-YD-ENDAKLFEQILKAE--YEFDS-------------------PY------------WDDISDSAKDFIRHLMEKDPEKRFT-----C------EQALQHPWIAGD----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
52 PsiBlast_CBE 61.1935%-130 - C1 -3COK PLK4_HUMAN A:[8-267] -----EKIEDFKVGNLLGKGSFAGVYRAESIHTGLEVAIKMIDKK--AMYKA--G--MVQRVQNEVKIHCQL-KHPSILELYNYFEDSNYVYLVLEMCHNGEMNRYLKNRVKPFSENEARHFMHQIITGMLYLHS-HGILHRDLTLSNLLL---TRN---MN---IKIADFGLATQLK-------------------------------ESDVWSLGCMFYTLLIGRPPF-DT-DTVK-----VVLAD--Y--EM-------------------PS------------F--LSIEAKDLIHQLLRRNPADRLS-----L------SSVLDHPFMS------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
97 PsiBlast_CBE 61.1234%-104 - C1 -2X8D CHK1_HUMAN A:[9-278] ----------WDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMK--RA--V--D--CPENIKKEICINKML-NHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIG-MPEPDAQRFFHQLMAGVVYLHG-IGITHRDIKPENLLL---DER---DN---LKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTAMLAGELPW-DQPSDSCQEYSDWKEKK--T--YL-------------------NP------------WKKIDSAPLALLHKILVENPSARIT-----I------PDIKKDRW-------YNKPLKKGAKRPRV-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
65 PsiBlast_CBE 61.0934%-108 - C1 -4FSN CHK1_HUMAN A:[7-276] ----------WDLVQTLGEGA-GEVQLAVNRVTEEAVAVKIVDM---------------ENIKKEICINKML-NHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIG-MPEPDAQRFFHQLMAGVVYLHG-IGITHRDIKPENLLL---DER---DN---LKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTAMLAGELPW-DQPSDSCQEYSDWKEKK--T--YL-------------------NP------------WKKIDSAPLALLHKILVENPSARIT-----I------PDIKKDRW-------YNKPLKKGAKRPRV-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
25 PsiBlast_CBE 61.0334%-134 - C1 -4FG9 KCC1A_HUMAN B:[14-279] ----EDIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAK--------------------EIAVLHKI-KHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGF-YTERDASRLIFQVLDAVKYLHD-LGIVHRDLKPENLLYYSLDED---SK---IMISDF-------------VLSTACGTPGYVAPEVLAQKPY-SKAVDCWSIGVIAYILLCGYPPF-YD-ENDAKLFEQILKAE--YEFDS-------------------PY------------WDDISDSAKDFIRHLMEKDPEKRFT-----C------EQALQHPWIAGD----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
53 PsiBlast_CBE 60.7435%-119 - C1 -2W4O KCC4_HUMAN A:[49-320] ----DALSDFFEVESELGRGATSIVYRCKQKGTQKPYALKVLKK---------------------IGVLLRL-SHPNIIKLKEIFETPTEISLVLELVTGGELFDRIVEKGY-YSERDAADAVKQILEAVAYLHE-NGIVHRDLKPENLLY---ATPAPDAP---LKIADF-------------------GTPGYCAPEILRGCAY-GPEVDMWSVGIITYILLCGFEPFYDE-RGDQFMFRRILNCE--Y--YFIS-----------------PW------------WDEVSLNAKDLVRKLIVLDPKKRLT-----T------FQALQHPWVTG-----------KAAN-FVHMD--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
26 PsiBlast_CBE 60.5934%-132 - C1 -4FG9 KCC1A_HUMAN A:[11-279] -KQAEDIRDIYDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKE-----------------ENEIAVLHKI-KHPNIVALDDIYESGGHLYLIMQLVSGGELFDRIVEKGF-YTERDASRLIFQVLDAVKYLHD-LGIVHRDLKPENLLYYSLDED---SK---IMISDF---------------------PGYVAPEVLAQKPY-SKAVDCWSIGVIAYILLCGYPPF-YD-ENDAKLFEQILKAE--YEFDS-------------------PY------------WDDISDSAKDFIRHLMEKDPEKRFT-----C------EQALQHPWIAGD----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
61 PsiBlast_CBE 60.4734%-107 - C1 -2HY0 CHK1_HUMAN A:[8-277] ----------WDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMK---------------NIKKEICINKML-NHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIG-MPEPDAQRFFHQLMAGVVYLHG-IGITHRDIKPENLLL---DER---DN---LKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTAMLAGELPW-DQPSDSCQEYSDWKEKK--T--YL-------------------NP------------WKKIDSAPLALLHKILVENPSARIT-----I------PDIKKDRW-------YNKPLKKGAKRPRV-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
64 PsiBlast_CBE 60.4234%-110 - C1 -2HOG CHK1_HUMAN A:[8-277] ----------WDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVDMK---------------NIKKEICINKML-NHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIG-MPEPDAQRFFHQLMAGVVYLHG-IGITHRDIKPENLLL---DER---DN---LKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTAMLAGELPW-DQPSDSCQEYSDWKEKK--T--YL-------------------NP------------WKKIDSAPLALLHKILVENPSARIT-----I------PDIKKDRW-------YNKPLKKGAKRPRV-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
80 PsiBlast_CBE 60.2334%-113 - C1 -4FSQ CHK1_HUMAN A:[8-277] ----------WDLVQTLG----GEVQLAVNRVTEEAVAVKIV-------------------IKKEICINKML-NHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIG-MPEPDAQRFFHQLMAGVVYLHG-IGITHRDIKPENLLL---DER---DN---LKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTAMLAGELPW-DQPSDSCQEYSDWKEKK--T--YL-------------------NP------------WKKIDSAPLALLHKILVENPSARIT-----I------PDIKKDRW-------YNKPLKKGAKRPRV-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
78 PsiBlast_CBE 60.1134%-110 - C1 -4FT0 CHK1_HUMAN A:[8-277] ----------WDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIVD----------------ENIKKEICINKML-NHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIG-MPEPDAQRFFHQLMAGVVYLHG-IGITHRDIKPENLLL---DER---DN---LKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTAMLAGELPW-DQPSDSCQEYSDWKEKK--T--YL-------------------NP------------WKKIDSAPLALLHKILVENPSARIT-----I------PDIKKDRW-------YNKPLKK----PRV-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
56 PsiBlast_CBE 60.0634%-112 - C1 -3TKH CHK1_HUMAN A:[9-278] ----------WDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIV------------------NIKKEICINKML-NHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIG-MPEPDAQRFFHQLMAGVVYLHG-IGITHRDIKPENLLL---DER---DN---LKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTAMLAGELPW-DQPSDSCQEYSDWKEKK--T--YL-------------------NP------------WKKIDSAPLALLHKILVENPSARIT-----I------PDIKKDRW-------YNKPLKKGAKRPRV-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
59 PsiBlast_CBE 59.9734%-106 - C1 -2QHM CHK1_HUMAN A:[9-278] ----------WDLVQTLG----GEVQLAVNRVTEEAVAVKIVDMK---------------NIKKEICINKML-NHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIG-MPEPDAQRFFHQLMAGVVYLHG-IGITHRDIKPENLLL---DER---DN---LKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTAMLAGELPW-DQPSDSCQEYSDWKEKK--T--YL-------------------NP------------WKKIDSAPLALLHKILVENPSARIT-----I------PDIKKDRW-------YNKPLKKGAKRPRV-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
75 PsiBlast_CBE 59.9334%-113 - C1 -4FTJ CHK1_HUMAN A:[8-277] ----------WDLVQTLGEGAYGEVQLAVNRVTEEAVAVKIV-------------------IKKEICINKML-NHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIG-MPEPDAQRFFHQLMAGVVYLHG-IGITHRDIKPENLLL---DER---DN---LKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTAMLAGELPW-DQPSDSCQEYSDWKEKK--T--YL-------------------NP------------WKKIDSAPLALLHKILVENPSARIT-----I------PDIKKDRW-------YNKPLKKGAKRPRV-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
84 PsiBlast_CBE 59.7735%-113 - C1 -3IGO ? A:[30-282] ----------------LGKGSFGEVLKCKDRITQQEYAVKVINKA--SAK-N--K---TSTILREVELLKKL-DHPNIMKLFEILEDSSSFYIVGELYTGGELFDEIIKRKR-FSEHDAARIIKQVFSGITYMHK-HNIVHRDLKPENILL---ESK---EKDCDIKIIDFGLSTCFQ-QNT---------TAYYIAPEVLRGT--YDEKCDVWSAGVILYILLSGTPPF-YG-KNEYDILKRVETGK--YAFDL-------------------PQ------------WRTISDDAKDLIRKMLTFHPSLRIT-----A------TQCLEHPWIQK-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
58 PsiBlast_CBE 59.5334%-111 - C1 -2QHN CHK1_HUMAN A:[9-278] ----------WDLVQTLG----GEVQLAVNRVTEEAVAVKIVDMK---------------NIKKEICINKML-NHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIG-MPEPDAQRFFHQLMAGVVYLHG-IGITHRDIKPENLLL---DER---DN---LKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTAMLAGELPW-DQPSDSCQEYSDWKEKK--T--YL-------------------NP------------WKKIDSAPLALLHKILVENPSARIT-----I------PDIKKDRW-------YNKPLKKGAKRPRV-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
74 PsiBlast_CBE 59.5134%-115 - C1 -4FTK CHK1_HUMAN A:[8-277] ----------WDLVQTL-----GEVQLAVNRVTEEAVAVKIV------------------NIKKEICINKML-NHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIG-MPEPDAQRFFHQLMAGVVYLHG-IGITHRDIKPENLLL---DER---DN---LKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTAMLAGELPW-DQPSDSCQEYSDWKEKK--T--YL-------------------NP------------WKKIDSAPLALLHKILVENPSARIT-----I------PDIKKDRW-------YNKPLKKGAKRPRV-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
69 PsiBlast_CBE 59.5134%-110 - C1 -4FTT CHK1_HUMAN A:[8-277] ----------WDLVQTLGE---GEVQLAVNRVTEEAVAVKIVD-----------------NIKKEICINKML-NHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIG-MPEPDAQRFFHQLMAGVVYLHG-IGITHRDIKPENLLL---DER---DN---LKISDFGLATVFRYNNRERLLNKMCGTLPYVAPELLKRREFHAEPVDVWSCGIVLTAMLAGELPW-DQPSDSCQEYSDWKEKK--T--YL-------------------NP------------WKKIDSAPLALLHKILVENPSARIT-----I------PDIKKDRW-------YNKPLKKGAKRPRV-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------