@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : MK01_HUMAN: (2013-07-23 )
MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

Atome Classification :

(78 SA) .........10......----..20........30........40........50.....-.-..60........70........80........90-..-.-.-.--...100.......110....-..-----.120.......130.......140.......150.......160........170-...-....180.......190.......200.......210.......220.-----------......230-------.......240.....-.-.250.......260.......270.......280.------------.......290.......300.......310.......320-..-.----.----...330...-....340.......350.......360
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MAAAAAAGAGPEMVRGQ----VFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKI-S-PFEHQTYCQRTLREIKILLRFRHENIIGINDIIR-AP-T-I-E--QMKDVYIVQDLMETDLYKLL-KT-----QHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTT-CDLKICDFGLAR-VAD-PDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS-----------NRPIFPGKH-------YLDQLNHILGILGSP-S-QEDLNCIINLKARNYLLSLPHKNKVPWNRLFP-NA------------DSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDE-PI-A----E----APFKFDMEL-DDLPKEKLKELIFEETARFQPGYRS
9 PsiBlast_CBE 96.67100%-139 - C1 -3I60 MK01_HUMAN A:[28-378] -------GAGPEMVRGQ----VFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKI-S-PFEHQTYCQRTLREIKILLRFRHENIIGINDIIR-AP-T-I-E--QMKDVYIVQDLMETDLYKLL-KT-----QHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTT-CDLKICDFGLAR-VAD--------------ATRWYRAPEIMLN---YTKSIDIWSVGCILAEMLS-----------NRPIFPGKH-------YLDQLNHILGILGSP-S-QEDLNCIINLKARNYLLSLPHKNKVPWNRLFP-NA------------DSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDE-PI-A----E----APFKFDMEL-DDLPKEKLKELIFEETARFQPGY--
25 PsiBlast_CBE 96.4299%-124 - C1 -1GOL MK01_RAT A:[8-364] ---AAAAAAGPEMVRGQ----VFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIRKI-S-PFEHQTYCQRTLREIKILLRFRHENIIGINDIIR-AP-T-I-E--QMKDVYIVQDLMETDLYKLL-KT-----QHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTT-CDLKICDFGLAR-VAD-PDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS-----------NRPIFPGKH-------YLDQLNHILGILGSP-S-QEDLNCIINLKARNYLLSLPHKNKVPWNRLFP-NA------------DSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDE-PI-A----E----APFKFDMEL-DDLPKEKLKELIFEETARFQPGYRS
8 PsiBlast_CBE 95.99100%-136 - C1 -4FV6 MK01_HUMAN A:[9-357] --------AGPEMVRGQ----VFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKI-S-PFEHQTYCQRTLREIKILLRFRHENIIGINDIIR-AP-T-I-E--QMKDVYIVQDLMETDLYKLL-KT-----QHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTT-CDLKICDFGLAR-VA---------------ATRWYRAPEIMLN---YTKSIDIWSVGCILAEMLS-----------NRPIFPGKH-------YLDQLNHILGILGSP-S-QEDLNCIINLKARNYLLSLPHKNKVPWNRLFP-NA------------DSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDE-PI-A----E----APFKFDMEL-DDLPKEKLKELIFEETARFQPG---
14 PsiBlast_CBE 95.5599%-131 - C1 -4H3P MK01_HUMAN D:[13-361] ----------PEMVRGQ----VFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKI-S-PFEHQTYCQRTLREIKILLAFRHENIIGINDIIR-AP-T-I-E--QMKDVYIVQDLMETDLYKLL-KT-----QHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTT-CDLKICDFGLAR-VAD-PDH-----------TRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS-----------NRPIFPGKH-------YLDQLNHILGILGSP-S-QEDLNCIINLKARNYLLSLPHKNKVPWNRLFP-NA------------DSKALDLLDKMLTFNPHKRIEVEQALAHPYLAQYYDPSDE-PI-A----E----APFKFDMEL-DDLPKEKLKELIFEETARFQPGYR-
19 PsiBlast_CBE 95.4699%-128 - C1 -4ERK MK01_RAT A:[12-361] -------AAGPEMVRGQ----VFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKI-S-PFEHQTYCQRTLREIKILLRFRHENIIGINDIIR-AP-T-I-E--QMKDVYIVQDLMETDLYKLL-KT-----QHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTT-CDLKICDFGLAR-VAD-PDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS-----------NRPIFPGKH-------YLDQLNHILGILGSP-S-QEDLNCIINLKARNYLLSLPHKNKVPWNRLFP-NA------------DSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDE-PI-A----E----APFKFDMEL-DDLPKEKLKELIFEETARFQPG---
11 PsiBlast_CBE 95.37100%-131 - C1 -2OJJ MK01_HUMAN A:[35-378] --------------RGQ----VFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKI-S-PFEHQTYCQRTLREIKILLRFRHENIIGINDIIR-AP-T-I-E--QMKDVYIVQDLMETDLYKLL-KT-----QHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTT-CDLKICDFGLAR-VAD-PDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS-----------NRPIFPGKH-------YLDQLNHILGILGSP-S-QEDLNCIINLKARNYLLSLPHKNKVPWNRLFP-NA------------DSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDE-PI-A----E----APFKFDMEL-DDLPKEKLKELIFEETARFQPGY--
10 PsiBlast_CBE 95.30100%-138 - C1 -3I5Z MK01_HUMAN A:[28-377] -------GAGPEMVRGQ----VFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKI-S-PFEHQTYCQRTLREIKILLRFRHENIIGINDIIR-AP-T-I-E--QMKDVYIVQDLMETDLYKLL-KT-----QHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTT-CDLKICDFGLAR-V---------------VATRWYRAPEIML-----TKSIDIWSVGCILAEMLS-----------NRPIFPGKH-------YLDQLNHILGILGSP-S-QEDLNCIINLKARNYLLSLPHKNKVPWNRLFP-NA------------DSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDE-PI-A----E----APFKFDMEL-DDLPKEKLKELIFEETARFQPG---
7 PsiBlast_PDB 94.8099%-129 - C1 -4H3P MK01_HUMAN A:[13-361] ----------PEMVRGQ----VFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKI-S-PFEHQTYCQRTLREIKILLAFRHENIIGINDIIR-AP-T-I-E--QMKDVYIVQDLMETDLYKLL-KT-----QHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTT-CDLKICDFGLAR-VAD-PDH-------EYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS-----------NRPIFPGKH-------YLDQLNHILGILGSP-S-QEDLNCIINLKARNYLLSLPHKNKVPWNRLFP-NA------------DSKALDLLDKMLTFNPHKRIEVEQALAHPYLAQYYDPSDE-PI-A----E----APFKFDMEL-DDLPKEKLKELIFEETARFQPGYR-
12 PsiBlast_CBE 94.57100%-129 - C1 -2OJI MK01_HUMAN A:[35-378] --------------RGQ----VFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKI-S-PFEHQTYCQRTLREIKILLRFRHENIIGINDIIR-AP-T-I-E--QMKDVYIVQDLMETDLYKLL-KT-----QHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTT-CDLKICDFGLAR-VAD-PDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS-----------NRPIFPGKH-------YLDQLNHILGILGSP-S-QEDLNCIINLKARNYLLSLPHKNKVPWNRLFP-NA------------DSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDE-PI-A----E----APFKFDMEL-DDLPKEKLKELIFEETARFQPGY--
21 PsiBlast_CBE 94.5099%-125 - C1 -3ERK MK01_RAT A:[12-361] -------AAGPEMVRGQ----VFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKI-S-PFEHQTYCQRTLREIKILLRFRHENIIGINDIIR-AP-T-I-E--QMKDVYIVQDLMETDLYKLL-KT-----QHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTT-CDLKICDFGLAR-VAD-PDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS-----------NRPIFPGKH-------YLDQLNHILGILGSP-S-QEDLNCIINLKARNYLLSLPHKNKVPWNRLFP-NA------------DSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDE-PI-A----E----APFKFDMEL-DDLPKEKLKELIFEETARFQPG---
6 PsiBlast_PDB 94.1599%-125 - C1 -3TEI MK01_HUMAN A:[12-360] ---------GPEMVRGQ----VFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKI-S-PFEHQTYCQRTLREIKILLAFRHENIIGINDIIR-AP-T-I-E--QMKDVYIVQDLMETDLYKLL-KT-----QHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTT-CDLKICDFGLAR-VAD-PDH-------EYVATRWYRAPEIMLN---YTKSIDIWSVGCILAEMLS-----------NRPIFPGKH-------YLDQLNHILGILGSP-S-QEDLNCIINLKARNYLLSLPHKNKVPWNRLFP-NA------------DSKALDLLDKMLTFNPHKRIEVEQALAHPYLAQYYDPSDE-PI-A----E----APFKFDMEL-DDLPKEKLKELIFEETARFQPGY--
3 PsiBlast_PDB 94.15100%-120 - C1 -1WZY MK01_HUMAN A:[16-365] -------GAGPEMVRGQ----VFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKI-S-PFEHQTYCQRTLREIKILLRFRHENIIGINDIIR-AP-T-I-E--QMKDVYIVQDLMETDLYKLL-KT-----QHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTT-CDLKICDFGLAR-VAD-PDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS-----------NRPIFPGKH-------YLDQLNHILGILGSP-S-QEDLNCIINLKARNYLLSLPHKNKVPWNRLFP-NA------------DSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDE-PI-A----E----APFKFDMEL-DDLPKEKLKELIFEETARFQPG---
5 PsiBlast_PDB 93.97100%-127 - C1 -1TVO MK01_HUMAN A:[8-357] -------GAGPEMVRGQ----VFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKI-S-PFEHQTYCQRTLREIKILLRFRHENIIGINDIIR-AP-T-I-E--QMKDVYIVQDLMETDLYKLL-KT-----QHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTT-CDLKICDFGLAR-VAD-PDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS-----------NRPIFPGKH-------YLDQLNHILGILGSP-S-QEDLNCIINLKARNYLLSLPHKNKVPWNRLFP-NA------------DSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDE-PI-A----E----APFKFDMEL-DDLPKEKLKELIFEETARFQPG---
13 PsiBlast_CBE 93.90100%-127 - C1 -2OJG MK01_HUMAN A:[39-377] ----------------------FDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKI-S-PFEHQTYCQRTLREIKILLRFRHENIIGINDIIR-AP-T-I-E--QMKDVYIVQDLMETDLYKLL-KT-----QHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTT-CDLKICDFGLAR-VAD-PDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS-----------NRPIFPGKH-------YLDQLNHILGILGSP-S-QEDLNCIINLKARNYLLSLPHKNKVPWNRLFP-NA------------DSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDE-PI-A----E----APFKF--EL-DDLPKEKLKELIFEETARFQPG---
18 PsiBlast_CBE 93.4399%-134 - C1 -2Z7L MK01_RAT A:[24-363] ---------------------VFDVGPRYTNLSYIGEG---MVCSAYDNLNKVRVAIKKI-S-PFEHQTYCQRTLREIKILLRFRHENIIGINDIIR-AP-T-I-E--QMKDVYIVQDLMETDLYKLL-KT-----QHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTT-CDLKICDFGLAR-VAD-PDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS-----------NRPIFPGKH-------YLDQLNHILGILGSP-S-QEDLNCIINLKARNYLLSLPHKNKVPWNRLFP-NA------------DSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDE-PI-A----E----APF---------LPKEKLKELIFEETARFQPG---
2 PsiBlast_PDB 93.22100%-129 - C1 -4FMQ MK01_HUMAN A:[11-360] --------AGPEMVRGQ----VFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKI-S-PFEHQTYCQRTLREIKILLRFRHENIIGINDIIR-AP-T-I-E--QMKDVYIVQDLMETDLYKLL-KT-----QHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTT-CDLKICDFGLAR-VAD-PDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS-----------NRPIFPGKH-------YLDQLNHILGILGSP-S-QEDLNCIINLKARNYLLSLPHKNKVPWNRLFP-NA------------DSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDE-PI-A----E----APFKFDMEL-DDLPKEKLKELIFEETARFQPGY--
24 PsiBlast_CBE 92.4298%-124 - C1 -4H3Q MK01_HUMAN A:[11-362] --------AGPEMVRGQ----VFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKI-S-PFEHQTYCQRTLREIKILLAFRHENIIGINDIIR-AP-T-I-E--QMKDVYIVQDLMETDLYKLL-KT-----QHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTT-SDLKICDFGLAR-VAD-PDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS-----------NRPIFPGKH-------YLDQLNHILGILGSP-S-QEDLNCGINLKARNYLLSLPHKNKVPWNRLFP-NA------------DSKALDLLDKMLTFNPHKRIEVEQALAHPYLAQYYDPSDE-PI-A----E----APFKFDMEL-DDLPKEKLKELIFEETARFQPGYRS
28 PsiBlast_CBE 91.3398%-130 - C1 -4I5H ? A:[10-357] ----------PEMVRGQ----VFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKI-S-PFEHQTYCQRTLREIKILLRFRHENIIGINDIIR-AP-T-I-E--QMKDVYIVADLMETDLYKLL-KT-----QHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTT-CDLKILDFGLAR-VAD-P-------LTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS-----------NRPIFPGKH-------YLDQLNHILGILGSP-S-QEDLNCIINLKARNYLLSLPHKNKVPWNRLFP-NA------------DSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDE-PI-A----E----APFK-------DLPKEKLKELIFEETARFQPGY--
63 PsiBlast_CBE 78.1250%-125 - C1 -4IC7 MK07_HUMAN A:[50-390] ---------------------TFDVGDEYEIIETIGNGAYGVVSSARRRLTGQQVAIKKIPN-AFDVVTNAKRTLRELKILKHFKHDNIIAIKDILR--P-T-V-PYGEFKSVYVVLDLMESDLHQIIHSS-----QPLTLEHVRYFLYQLLRGLKYMHSAQVIHRDLKPSNLLVNEN-CELKIGDFGMARGLCT-SPAEHQYFMTEYVATRWYRAPELMLSLHEYTQAIDLWSVGCIFGEMLA-----------RRQLFPGKN-------YVHQLQLIMMVLGTP-S-PAVIQAVGAERVRAYIQSLPPRQPVPWETVYP-GA------------DRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDE-PD-C----A----PPFDFAFDR-EALTRERIKEAIVAEIEDF------
62 PsiBlast_CBE 77.8550%-123 - C1 -4IC7 MK07_HUMAN D:[50-390] ---------------------TFDVGDEYEIIETIGNGAYGVVSSARRRLTGQQVAIKKIPN-AFDVVTNAKRTLRELKILKHFKHDNIIAIKDILR--P-T-V-PYGEFKSVYVVLDLMESDLHQIIHSS-----QPLTLEHVRYFLYQLLRGLKYMHSAQVIHRDLKPSNLLVNEN-CELKIGDFGMARGLCT-SPAEHQYFMTEYVATRWYRAPELMLSLHEYTQAIDLWSVGCIFGEMLA-----------RRQLFPGKN-------YVHQLQLIMMVLGTP-S-PAVIQAVGAERVRAYIQSLPPRQPVPWETVYP-GA------------DRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDE-PD-C----A----PPFDFAFDR-EALTRERIKEAIVAEIEDF------
111 HHSearch 76.6651%-124 - C1 -2B9H FUS3_YEAST A:[5-352] ----------------I----VYNISSDFQLKSLLGEGAYGVVCSATHKPTGEIVAIKKI-E-PFDKPLFALRTLREIKILKHFKHENIITIFNIQR-PD-S-F-E--NFNEVYIIQELMQTDLHRVI-ST-----QMLSDDHIQYFIYQTLRAVKVLHGSNVIHRDLKPSNLLINSN-CDLKVCDFGLAR-IID----------VEFVATRWYRAPEVMLTSAKYSRAMDVWSCGCILAELFL-----------RRPIFPGRD-------YRHQLLLIFGIIGTP-HSDNDLRCIESPRAREYIKSLPMYPAAPLEKMFP-RV------------NPKGIDLLQRMLVFDPAKRITAKEALEHPYLQTYHDPNDE-PE-GEPIPP----SFFEFDHYK-EALTTKDLKKLIWNEIF--------
61 PsiBlast_CBE 76.4950%-129 - C1 -4B99 MK07_HUMAN A:[49-389] ---------------------TFDVGDEYEIIETIGNGAYGVVSSARRRLTGQQVAIKKIPN-AFDVVTNAKRTLRELKILKHFKHDNIIAIKDILR--P-T-V-PYGEFKSVYVVLDLMESDLHQIIHSS-----QPLTLEHVRYFLYQLLRGLKYMHSAQVIHRDLKPSNLLVNEN-CELKIGDFGMARGL--------QYFMTEYVATRWYRAPELMLSLHEYTQAIDLWSVGCIFGEMLA-----------RRQLFPGKN-------YVHQLQLIMMVLGTP-S-PAVIQ-----RVRAYIQSLPPRQPVPWETVYP-GA------------DRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDE-PD-C----A----PPFDFAFDR-EALTRERIKEAIVAEIEDF------
79 PsiBlast_CBE 76.4748%-121 - C1 -3FKL MK14_HUMAN A:[29-362] ---------------------IWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKL-SRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPAR-S-L-E--EFNDVYLVTHLMGADLNNIV-KC-----QKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNED-CELKILDFGLA-------E------MTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLT-----------GRTLFPGTD-------HIDQLKLILRLVGTP-G-AELLKKISSESARNYIQSLTQMPKMNFANVFI-GA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDE-PV-A----D-----PYDQSFES-RDLLIDEWKSLTYDEVISFVP----
52 PsiBlast_CBE 76.4750%-125 - C1 -2B9F FUS3_YEAST A:[1-350] ------------MPKRI----VYNISSDFQLKSLLGEGAYGVVCSATHKPTGEIVAIKKI-E-PFDKPLFALRTLREIKILKHFKHENIITIFNIQR-PD-S-F-E--NFNEVYIIQELMQTDLHRVI-ST-----QMLSDDHIQYFIYQTLRAVKVLHGSNVIHRDLKPSNLLINSN-CDLKVCDFGLAR-IID----------TEYVATRWYRAPEVMLTSAKYSRAMDVWSCGCILAELFL-----------RRPIFPGRD-------YRHQLLLIFGIIGTPHS-DNDLRCIESPRAREYIKSLPMYPAAPLEKMFP-RV------------NPKGIDLLQRMLVFDPAKRITAKEALEHPYLQTYHDPNDE-PE-G----EPIPPSFFEFDHYK-EALTTKDLKKLIWNE----------
83 PsiBlast_CBE 76.4448%-128 - C1 -4F9Y ? A:[40-373] ---------------------IWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKL-SRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPAR-S-L-E--EFNDVYLVTHLMGADLNNIV-KC-----QKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNED-CELKILDFGLA------------------VATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLT-----------GRTLFPGTD-------HIDQLKLILRLVGTP-G-AELLKKISSESARNYIQSLTQMPKMNFANVFI-GA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDE-PV-A----D-----PYDQSFES-RDLLIDEWKSLTYDEVISFVP----
91 PsiBlast_CBE 76.2948%-128 - C1 -3KF7 MK14_HUMAN A:[17-350] ---------------------IWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKL-SRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPAR-S-L-E--EFNDVYLVTHLMGADLNNIV-KC-----QKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNED-CELKILDFGL-------------------VATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLT-----------GRTLFPGTD-------HIDQLKLILRLVGTP-G-AELLKKISSESARNYIQSLTQMPKMNFANVFI-GA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDE-PV-A----D-----PYDQSFES-RDLLIDEWKSLTYDEVISFVP----
65 PsiBlast_CBE 76.0247%-126 - C1 -3K3I MK14_HUMAN A:[3-348] ---------RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKL-SRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPAR-S-L-E--EFNDVYLVTHLMGADLNNI----------KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNED-CELKILDFG--------------------VATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLT-----------GRTLFPGTD-------HIDQLKLILRLVGTP-G-AELLKKISSESARNYIQSLTQMPKMNFANVFI-GA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDE-PV-A----D-----PYDQSFES-RDLLIDEWKSLTYDEVISFVP----
82 PsiBlast_CBE 75.9248%-127 - C1 -4FA2 ? A:[40-373] ---------------------IWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKL-SRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPAR-S-L-E--EFNDVYLVTHLMGADLNNIV-KC-----QKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNED-CELKILDFGL-------------------VATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLT-----------GRTLFPGTD-------HIDQLKLILRLVGTP-G-AELLKKISSESARNYIQSLTQMPKMNFANVFI-GA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDE-PV-A----D-----PYDQSFES-RDLLIDEWKSLTYDEVISFVP----
84 PsiBlast_CBE 75.8448%-127 - C1 -4F9W ? A:[40-373] ---------------------IWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKL-SRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPAR-S-L-E--EFNDVYLVTHLMGADLNNIV-KC-----QKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNED-CELKILDFGLA--------------------TRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLT-----------GRTLFPGTD-------HIDQLKLILRLVGTP-G-AELLKKISSESARNYIQSLTQMPKMNFANVFI-GA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDE-PV-A----D-----PYDQSFES-RDLLIDEWKSLTYDEVISFVP----
58 PsiBlast_CBE 75.6950%-123 - C1 -2B9I FUS3_YEAST A:[1-350] ------------MPKRI----VYNISSDFQLKSLLGEGAYGVVCSATHKPTGEIVAIKKI-E-PFDKPLFALRTLREIKILKHFKHENIITIFNIQR-PD-S-F-E--NFNEVYIIQELMQTDLHRVI-ST-----QMLSDDHIQYFIYQTLRAVKVLHGSNVIHRDLKPSNLLINSN-CDLKVCDFGLAR-IIDE---------VEFVATRWYRAPEVMLTSAKYSRAMDVWSCGCILAELFL-----------RRPIFPGRD-------YRHQLLLIFGIIGTPHS-DNDLRCIESPRAREYIKSLPMYPAAPLEKMFP-RV------------NPKGIDLLQRMLVFDPAKRITAKEALEHPYLQTYHDPNDE-PE-G----EPIPPSFFEFDHYK-EALTTKDLKKLIWNE----------
100 HHSearch 75.5841%-126 - C1 -3N9X ? A:[20-412] ----------------K----NVHVPDNYIIKHLIGRGSYGYVYLAYDKNTEKNVAIKKVNR-MFEDLIDCKRILREITILNRLKSDYIIRLYDLII-PD-D-L-L--KFDELYIVLEIADSDLKKLF-KTP----IFLTEEHIKTILYNLLLGENFIHESGIIHRDLKPANCLLNQD-CSVKVCDFGLAR-TI-------------HVVTRWYRAPELILLQENYTKSIDIWSTGCIFAELLNMLQSHINDPTNRFPLFPGSSCFPHEKSNRDQLNIIFNIIGTP-T-EDDLKNINKPEVIKYIKLFPHRKPINLKQKYP-SI------------SDDGINLLESMLKFNPNKRITIDQALDHPYLKDVRKKKLE---------T----KKIILPFDDWMVLSETQLRYIFLKEVQSFHPELV-
81 PsiBlast_CBE 75.4548%-127 - C1 -1OZ1 MK14_HUMAN A:[29-362] ---------------------IWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKL-SRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPAR-S-L-E--EFNDVYLVTHLMGADLNNIV----------LTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNED-CELKILDFGLAR-HTD-DE------MTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLT-----------GRTLFPGTD-------HIDQLKLILRLVGTP-G-AELLKKISSESARNYIQSLTQMPKMNFANVFI-GA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDE-PV-A----D-----PYDQSFES-RDLLIDEWKSLTYDEVISFVP----
57 PsiBlast_CBE 75.2950%-124 - C1 -2B9J FUS3_YEAST A:[1-350] ------------MPKRI----VYNISSDFQLKSLLGEGAYGVVCSATHKPTGEIVAIKKI-E-PFDKPLFALRTLREIKILKHFKHENIITIFNIQR-PD-S-F-E--NFNEVYIIQELMQTDLHRVI-ST-----QMLSDDHIQYFIYQTLRAVKVLHGSNVIHRDLKPSNLLINSN-CDLKVCDFGLAR-IID----------VEFVATRWYRAPEVMLTSAKYSRAMDVWSCGCILAELFL-----------RRPIFPGRD-------YRHQLLLIFGIIGTPHS-DNDLRCIESPRAREYIKSLPMYPAAPLEKMFP-RV------------NPKGIDLLQRMLVFDPAKRITAKEALEHPYLQTYHDPNDE-PE-G----EPIPPSFFEFDHYK-EALTTKDLKKLIWNE----------
95 PsiBlast_CBE 75.2548%-128 * C1 *3HL7 MK14_HUMAN A:[17-350] ---------------------IWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKL-SRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPAR-S-L-E--EFNDVYLVTHLMGADLNNIV-KC-----QKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNED-CELKILDFGLA-------------------ATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLT-----------GRTLFPGTD-------HIDQLKLILRLVGTP-G-AELLKKISSESARNYIQSLTQMPKMNFANVFI-GA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDE-PV-A----D-----PYDQSFES-RDLLIDEWKSLTYDEVISFVP----
94 PsiBlast_CBE 75.1848%-127 - C1 -3HLL MK14_HUMAN A:[17-350] ---------------------IWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKL-SRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPAR-S-L-E--EFNDVYLVTHLMGADLNNIV-KC-----QKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNED-CELKILDFGL-------------------VATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLT-----------GRTLFPGTD-------HIDQLKLILRLVGTP-G-AELLKKISSESARNYIQSLTQMPKMNFANVFI-GA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDE-PV-A----D-----PYDQSFES-RDLLIDEWKSLTYDEVISFVP----
71 PsiBlast_CBE 74.9948%-123 - C1 -3FMH MK14_HUMAN A:[29-362] ---------------------IWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKL-SRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPAR-S-L-E--EFNDVYLVTHLMGADLNNIV-KC-----QKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNED-CELKILDFGL---HTD-DE------MTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLT-----------GRTLFPGTD-------HIDQLKLILRLVGTP-G-AELLKKISSESARNYIQSLTQMPKMNFANVFI-GA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDE-PV-A----D-----PYDQSFES-RDLLIDEWKSLTYDEVISFVP----
96 PsiBlast_CBE 74.9648%-126 - C1 -2ZB1 MK14_HUMAN A:[17-350] ---------------------IWEVPERYQNLSPVG--AYGSVCAAFDTKTGLRVAVKKL-SRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPAR-S-L-E--EFNDVYLVTHLMGADLNNIV-KC-----QKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNED-CELKILDFGL---HTD-DE------MTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLT-----------GRTLFPGTD-------HIDQLKLILRLVGTP-G-AELLKKISSESARNYIQSLTQMPKMNFANVFI-GA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDE-PV-A----D-----PYDQSFES-RDLLIDEWKSLTYDEVISFVP----
73 PsiBlast_CBE 74.9448%-123 - C1 -3FLY MK14_HUMAN A:[29-362] ---------------------IWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKL-SRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPAR-S-L-E--EFNDVYLVTHLMGADLNNIV-KC-----QKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNED-CELKILDFGL---HTD-DE------MTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLT-----------GRTLFPGTD-------HIDQLKLILRLVGTP-G-AELLKKISSESARNYIQSLTQMPKMNFANVFI-GA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDE-PV-A----D-----PYDQSFES-RDLLIDEWKSLTYDEVISFVP----
72 PsiBlast_CBE 74.9448%-125 - C1 -3FLZ MK14_HUMAN A:[29-362] ---------------------IWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKL-SRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPAR-S-L-E--EFNDVYLVTHLMGADLNNIV-KC-----QKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNED-CELKILDFGL---HTD-DE------MTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLT-----------GRTLFPGTD-------HIDQLKLILRLVGTP-G-AELLKKISSESARNYIQSLTQMPKMNFANVFI-GA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDE-PV-A----D-----PYDQSFES-RDLLIDEWKSLTYDEVISFVP----