@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : MK12_HUMAN: (2015-06-17 )
MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPL

Atome Classification :

(44 SA) .........10........20........30........40........50........60........70........80........90........100.......110.......120........130.......140.......150.......160.......170.......180.........190.......200.......210.......220.......230.......240.......250.......260.......270.......280----------.........290.......300.......310.......320.-.-.-....330.......340.......350.......360.....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMK-HEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADS--EMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNA------------SPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQV-Q-K-YDDSFDDVDRTLDEWKRVTYKEVLSFKPPRQLGARVSKETPL
117 HHSearch 95.32100%-125 - C1 -1CM8 MK12_HUMAN A:[8-353] -------RSGFYRQEVTKTAWEVRAVYRDLQPV------AVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMK-HEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADS--EMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNA------------SPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLH------QV-Q-K-YDDS-----RTLDEWKRVTYKEVLSFKP--------------
1 PsiBlast_PDB 95.0799%-125 - C1 -1CM8 MK12_HUMAN A:[8-353] -------RSGFYRQEVTKTAWEVRAVYRDLQPV------AVCSAVDGRTGAKVAIKKLYRPFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLMK-HEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADS--EMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNA------------SPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLH------QV-Q-K-YDDS-----RTLDEWKRVTYKEVLSFKP--------------
86 PsiBlast_CBE 86.0963%-116 - C1 -3FSK MK14_HUMAN A:[17-363] -------RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDF------DD--EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-P-YDQSFESRDLLIDEWKSLTYDEVISFVPPP------------
20 PsiBlast_PDB 86.0263%-113 - C1 -3FLZ MK14_HUMAN A:[16-363] ------ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGL--HTDD--EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-P-YDQSFESRDLLIDEWKSLTYDEVISFVPPP------------
18 PsiBlast_PDB 85.8863%-116 - C1 -3FLW MK14_HUMAN A:[16-363] ------ERPTFYRQELN-TIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFG---HTDD--EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-P-YDQSFESRDLLIDEWKSLTYDEVISFVPPP------------
87 PsiBlast_CBE 85.5463%-117 - C1 -3FSF MK14_HUMAN A:[17-363] -------RPTFYRQELNKTIWEVPERYQNLSPVG-----SVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFG---HTDD--EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-P-YDQSFESRDLLIDEWKSLTYDEVISFVPPP------------
81 PsiBlast_CBE 85.3663%-113 - C1 -3HRB MK14_HUMAN A:[4-350] -------RPTFYRQELNKTIWEVPERYQNLSPVG-----SVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDD--EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-P-YDQSFESRDLLIDEWKSLTYDEVISFVPPP------------
60 PsiBlast_CBE 85.3263%-116 - C1 -2ZAZ MK14_HUMAN A:[5-351] -------RPTFYRQELNKTIWEVPERYQNLSPVG----GSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDD--EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-P-YDQSFESRDLLIDEWKSLTYDEVISFVPPP------------
6 PsiBlast_PDB 85.2762%-116 - C1 -4F9Y MK14_HUMAN A:[28-374] -------RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLA------------VATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-P-YDQSFESRDLLIDEWKSLTYDEVISFVPPPL-----------
66 PsiBlast_CBE 85.2463%-121 - C1 -1WBO MK14_HUMAN A:[5-351] -------RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDD--EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-P-YDQSFESRDLLIDEWKSLTYDEVISFVPPPLD----------
75 PsiBlast_CBE 85.0463%-117 - C1 -3K3I MK14_HUMAN A:[3-349] -------RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNI-----KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFG--------------VATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-P-YDQSFESRDLLIDEWKSLTYDEVISFVPPP------------
70 PsiBlast_CBE 85.0063%-115 - C1 -1W82 MK14_HUMAN A:[5-351] -------RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDD--EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-P-YDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQ---------
68 PsiBlast_CBE 84.9863%-116 - C1 -1W84 MK14_HUMAN A:[5-351] -------RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDD--EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-P-YDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQ---------
65 PsiBlast_CBE 84.8863%-116 - C1 -1WBS MK14_HUMAN A:[5-351] -------RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDD--EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-P-YDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQ---------
19 PsiBlast_PDB 84.8463%-112 - C1 -3FLY MK14_HUMAN A:[16-363] ------ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGL--HTDD--EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-P-YDQSFESRDLLIDEWKSLTYDEVISFVPPP------------
58 PsiBlast_CBE 84.7963%-117 - C1 -2ZB1 MK14_HUMAN A:[5-351] -------RPTFYRQELNKTIWEVPERYQNLSPVG--AYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGL--HTDD--EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-P-YDQSFESRDLLIDEWKSLTYDEVISFVPPP------------
77 PsiBlast_CBE 84.7263%-116 - C1 -4AA4 MK14_HUMAN A:[10-356] -------RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIV-----LTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDD--EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-P-YDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQ---------
71 PsiBlast_CBE 84.7163%-117 - C1 -1W7H MK14_HUMAN A:[5-351] -------RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDD--EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-P-YDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQ---------
45 PsiBlast_CBE 84.6763%-122 - C1 -3P78 MK14_MOUSE A:[11-357] -------RPTFYRQELNKTIWEVPERYQNLSPVGS---GSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFG---------------ATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-P-YDQSFESRDLLIDEWKSLTYDEVISFVPPP------------
5 PsiBlast_PDB 84.5962%-117 - C1 -4F9W MK14_HUMAN A:[28-374] -------RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLA--------------TRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-P-YDQSFESRDLLIDEWKSLTYDEVISFVPPP------------
51 PsiBlast_CBE 84.5763%-115 - C1 -3RIN MK14_HUMAN A:[5-351] -------RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDD--EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-P-YDQSFESRDLLIDEWKSLTYDEVISFVPPP------------
46 PsiBlast_CBE 84.5563%-122 - C1 -3P5K MK14_MOUSE A:[11-357] -------RPTFYRQELNKTIWEVPERYQNLSPVGS---GSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFG---------------ATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-P-YDQSFESRDLLIDEWKSLTYDEVISFVPPP------------
26 PsiBlast_CBE 84.5063%-114 - C1 -3U8W MK14_HUMAN A:[11-357] -------RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDD--EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-P-YDQSFESRDLLIDEWKSLTYDEVISFVPPP------------
7 PsiBlast_PDB 84.5062%-115 - C1 -4FA2 MK14_HUMAN A:[27-374] ------ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGL-------------VATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-P-YDQSFESRDLLIDEWKSLTYDEVISFVPPPL-----------
13 PsiBlast_PDB 84.2163%-112 - C1 -3FKL MK14_HUMAN A:[16-363] ------ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLA-------EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-P-YDQSFESRDLLIDEWKSLTYDEVISFVPPP------------
78 PsiBlast_CBE 84.2063%-117 - C1 -4AA0 MK14_HUMAN A:[10-356] -------RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADL--------KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFG--------------VATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-P-YDQSFESRDLLIDEWKSLTYDEVISFVPPP------------
63 PsiBlast_CBE 84.1663%-116 - C1 -1WBV MK14_HUMAN A:[5-351] -------RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDD--EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-P-YDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQ---------
41 PsiBlast_CBE 84.1063%-122 - C1 -3P7C MK14_MOUSE A:[11-357] -------RPTFYRQELNKTIWEVPERYQNLSPVGS---GSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFG---------------ATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-P-YDQSFESRDLLIDEWKSLTYDEVISFVPPP------------
8 PsiBlast_PDB 83.6063%-117 - C1 -3D7Z MK14_HUMAN A:[5-351] -------RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDD--EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-P-YDQSFESRDLLIDEWKSLTYDEVISFVPPP------------
42 PsiBlast_CBE 83.5563%-117 - C1 -3P7B MK14_MOUSE A:[11-357] -------RPTFYRQELNKTIWEVPERYQNLSPVGS---GSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFG---------------ATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-P-YDQSFESRDLLIDEWKSLTYDEVISFVPPP------------
27 PsiBlast_CBE 83.4463%-116 - C1 -3LHJ MK14_HUMAN A:[11-357] -------RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGL---------MTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-P-YDQSFESRDLLIDEWKSLTYDEVISFVPPP------------
25 PsiBlast_CBE 83.0063%-118 - C1 -3ZYA MK14_HUMAN A:[11-357] -------RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLA--------------TRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-P-YDQSFESRDLLIDEWKSLTYDEVISFVPPPL-----------
43 PsiBlast_CBE 82.9763%-115 - C1 -3P7A MK14_MOUSE A:[11-357] -------RPTFYRQELNKTIWEVPERYQNLSPVGS---GSVCAAFDTKTGHRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFG---------------ATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-P-YDQSFESRDLLIDEWKSLTYDEVISFVPPP------------
29 PsiBlast_CBE 82.9763%-113 - C1 -3GFE MK14_HUMAN A:[11-357] -------RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDD--EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-P-YDQSFESRDLLIDEWKSLTYDEVISFVPPP------------
73 PsiBlast_CBE 82.8763%-113 - C1 -1KV1 MK14_HUMAN A:[5-351] -------RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIV-----LTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFG---------------ATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-P-YDQSFESRDLLIDEWKSLTYDEVISFVPPP------------
94 PsiBlast_CBE 82.7963%-116 - C1 -4EHV MK14_HUMAN A:[5-351] -------RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGL-------------VATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-P-YDQSFESRDLLIDEWKSLTYDEVISFVPPP------------