@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : MK14_HUMAN: (2013-07-23 )
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES

Atome Classification :

(80 SA) .........10........20........30........40........50........60........70........80........90........100.......-110......-.120.......130.......140.......150.......160.......170...-------..--..180.......190.......200.......210.......220.......230.......240.-......250.......260..-.....270.....------------..280.......290.......300.......310.......320-....-----....330.......340.......350.......360
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLM-GADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHT-------DD--EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPG-AELLKKISSESARNYIQSLTQ-MPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-PYDQ-----SFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
44 PsiBlast_CBE 99.01100%-135 - C1 -1WBO MK14_HUMAN A:[4-354] ---ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLM-GADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHT-------DD--EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPG-AELLKKISSESARNYIQSLTQ-MPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-PYDQ-----SFESRDLLIDEWKSLTYDEVISFVPPPLD------
88 PsiBlast_CBE 96.41100%-134 - C1 -4EH2 MK14_HUMAN A:[4-354] ---ERPTFYRQELNKTIWEVPERYQNLSPVGS--YGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLM-GADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFG---------------------VATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPG-AELLKKISSESARNYIQSLTQ-MPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-PYDQ-----SFESRDLLIDEWKSLTYDEVISFVPPPLD------
16 PsiBlast_PDB 96.37100%-134 - C1 -1BL7 MK14_HUMAN A:[23-373] ---ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLM-GADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHT-------DD--EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPG-AELLKKISSESARNYIQSLTQ-MPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-PYDQ-----SFESRDLLIDEWKSLTYDEVISFVPPPLD------
99 PsiBlast_CBE 96.22100%-138 - C1 -3HV5 MK14_HUMAN A:[4-352] ---ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLM-GADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLA-------------------VATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPG-AELLKKISSESARNYIQSLTQ-MPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-PYDQ-----SFESRDLLIDEWKSLTYDEVISFVPPP--------
13 PsiBlast_PDB 96.03100%-134 - C1 -3ZYA MK14_HUMAN A:[7-359] MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLM-GADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLA---------------------TRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPG-AELLKKISSESARNYIQSLTQ-MPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-PYDQ-----SFESRDLLIDEWKSLTYDEVISFVPPPL-------
101 PsiBlast_CBE 96.01100%-137 - C1 -3HV4 MK14_HUMAN A:[4-352] ---ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLM-GADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLA-------------------VATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPG-AELLKKISSESARNYIQSLTQ-MPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-PYDQ-----SFESRDLLIDEWKSLTYDEVISFVPPP--------
63 PsiBlast_CBE 95.73100%-133 - C1 -3FMJ MK14_HUMAN A:[16-364] ---ERPTFYRQELNKTIWEVPERYQNLSPVG---YGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLM-GADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFG--RHT-------DD--EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPG-AELLKKISSESARNYIQSLTQ-MPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-PYDQ-----SFESRDLLIDEWKSLTYDEVISFVPPP--------
36 PsiBlast_CBE 95.73100%-131 - C1 -2ZB1 MK14_HUMAN A:[4-352] ---ERPTFYRQELNKTIWEVPERYQNLSPVG--AYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLM-GADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGL--HT-------DD--EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPG-AELLKKISSESARNYIQSLTQ-MPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-PYDQ-----SFESRDLLIDEWKSLTYDEVISFVPPP--------
82 PsiBlast_CBE 95.69100%-134 - C1 -4EH8 MK14_HUMAN A:[4-354] ---ERPTFYRQELNKTIWEVPERYQNLSPVGS--YGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLM-GADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDF----------------------VATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPG-AELLKKISSESARNYIQSLTQ-MPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-PYDQ-----SFESRDLLIDEWKSLTYDEVISFVPPPLD------
37 PsiBlast_CBE 95.62100%-131 - C1 -2ZB0 MK14_HUMAN A:[4-352] ---ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLM-GADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHT-------DD--EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPG-AELLKKISSESARNYIQSLTQ-MPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-PYDQ-----SFESRDLLIDEWKSLTYDEVISFVPPP--------
80 PsiBlast_CBE 95.40100%-133 - C1 -4EHV MK14_HUMAN A:[5-352] ----RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLM-GADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGL--------------------VATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPG-AELLKKISSESARNYIQSLTQ-MPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-PYDQ-----SFESRDLLIDEWKSLTYDEVISFVPPP--------
100 PsiBlast_CBE 95.31100%-135 - C1 -3HV4 MK14_HUMAN B:[5-352] ----RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLM-GADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLA-------------------VATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPG-AELLKKISSESARNYIQSLTQ-MPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-PYDQ-----SFESRDLLIDEWKSLTYDEVISFVPPP--------
76 PsiBlast_CBE 95.30100%-135 - C1 -3MW1 MK14_HUMAN A:[3-351] ---ERPTFYRQELNKTIWEVPERYQNLSPVGS-----VCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLM-GADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLA--T-------DD--EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPG-AELLKKISSESARNYIQSLTQ-MPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-PYDQ-----SFESRDLLIDEWKSLTYDEVISFVPPP--------
97 PsiBlast_CBE 95.23100%-135 - C1 -3HV6 MK14_HUMAN A:[4-352] ---ERPTFYRQELNKTIWEVPERYQNLSPVGS----SVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLM-GADLNNIVK---KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFG---------------------VATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPG-AELLKKISSESARNYIQSLTQ-MPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-PYDQ-----SFESRDLLIDEWKSLTYDEVISFVPPP--------
11 PsiBlast_PDB 95.22100%-131 - C1 -3ITZ MK14_HUMAN A:[7-359] MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLM-GADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHT-------DD--EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPG-AELLKKISSESARNYIQSLTQ-MPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-PYDQ-----SFESRDLLIDEWKSLTYDEVISFVPPPL-------
35 PsiBlast_CBE 95.10100%-136 - C1 -3HL7 MK14_HUMAN A:[6-352] -----PTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLM-GADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLA--------------------ATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPG-AELLKKISSESARNYIQSLTQ-MPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-PYDQ-----SFESRDLLIDEWKSLTYDEVISFVPPP--------
34 PsiBlast_CBE 95.06100%-131 - C1 -3HLL MK14_HUMAN A:[5-352] ----RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLM-GADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGL--------------------VATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPG-AELLKKISSESARNYIQSLTQ-MPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-PYDQ-----SFESRDLLIDEWKSLTYDEVISFVPPP--------
19 PsiBlast_PDB 95.06100%-135 - C1 -3HA8 MK14_HUMAN A:[23-371] ---ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLM-GADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDF--------------D--EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPG-AELLKKISSESARNYIQSLTQ-MPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-PYDQ-----SFESRDLLIDEWKSLTYDEVISFVPPP--------
98 PsiBlast_CBE 95.01100%-135 - C1 -3HV5 MK14_HUMAN B:[4-352] ---ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLM-GADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLA-------------------VATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPG-AELLKKISSESARNYIQSLTQ-MPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-PYDQ-----SFESRDLLIDEWKSLTYDEVISFVPPP--------
10 PsiBlast_PDB 94.90100%-130 - C1 -3GFE MK14_HUMAN A:[7-358] MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLM-GADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHT-------DD--EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPG-AELLKKISSESARNYIQSLTQ-MPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-PYDQ-----SFESRDLLIDEWKSLTYDEVISFVPPP--------
12 PsiBlast_PDB 94.88100%-135 - C1 -3LHJ MK14_HUMAN A:[11-358] ----RPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLM-GADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGL----------------MTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPG-AELLKKISSESARNYIQSLTQ-MPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-PYDQ-----SFESRDLLIDEWKSLTYDEVISFVPPP--------
77 PsiBlast_CBE 94.85100%-130 - C1 -3HRB MK14_HUMAN A:[3-351] ---ERPTFYRQELNKTIWEVPERYQNLSPVGS-----VCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLM-GADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHT-------DD--EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPG-AELLKKISSESARNYIQSLTQ-MPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-PYDQ-----SFESRDLLIDEWKSLTYDEVISFVPPP--------
65 PsiBlast_CBE 94.81100%-130 - C1 -3FLZ MK14_HUMAN A:[16-364] ---ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLM-GADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGL--HT-------DD--EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPG-AELLKKISSESARNYIQSLTQ-MPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-PYDQ-----SFESRDLLIDEWKSLTYDEVISFVPPP--------
56 PsiBlast_CBE 94.77100%-134 - C1 -3HVC MK14_HUMAN A:[7-354] ----RPTFYRQELNKTIWEVPERYQNLSPVGS---GSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLM-GADLNNIV-----LTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFG-----------------------TRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPG-AELLKKISSESARNYIQSLTQ-MPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-PYDQ-----SFESRDLLIDEWKSLTYDEVISFVPPP--------
29 PsiBlast_CBE 94.74100%-131 - C1 -3RIN MK14_HUMAN A:[4-352] ---ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLM-GADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHT-------DD--EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPG-AELLKKISSESARNYIQSLTQ-MPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-PYDQ-----SFESRDLLIDEWKSLTYDEVISFVPPP--------
20 PsiBlast_PDB 94.68100%-132 - C1 -3K3J MK14_HUMAN A:[7-354] ----RPTFYRQELNKTIWEVPERYQNLSPVGSG--GSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLM-GADLNNI-----KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDF----------------------VATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPG-AELLKKISSESARNYIQSLTQ-MPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-PYDQ-----SFESRDLLIDEWKSLTYDEVISFVPPP--------
83 PsiBlast_CBE 94.64100%-130 - C1 -4EH7 MK14_HUMAN A:[4-354] ---ERPTFYRQELNKTIWEVPERYQNLSPVGS--YGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLM-GADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFG---------------------VATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPG-AELLKKISSESARNYIQSLTQ-MPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-PYDQ-----SFESRDLLIDEWKSLTYDEVISFVPPPLD------
52 PsiBlast_CBE 94.64100%-129 - C1 -1DI9 MK14_HUMAN A:[4-351] ---ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLM-GADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHT-------DD--EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPG-AELLKKISSESARNYIQSLTQ-MPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-PYDQ-----SFESRDLLIDEWKSLTYDEVISFVPP---------
84 PsiBlast_CBE 94.62100%-134 - C1 -4EH6 MK14_HUMAN A:[4-354] ---ERPTFYRQELNKTIWEVPERYQNLSPVGS--YGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLM-GADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDF-----------------------ATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPG-AELLKKISSESARNYIQSLTQ-MPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-PYDQ-----SFESRDLLIDEWKSLTYDEVISFVPPPLD------
71 PsiBlast_CBE 94.61100%-130 - C1 -3FKN MK14_HUMAN A:[16-364] ---ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLM-GADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFG---HT-------DD--EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPG-AELLKKISSESARNYIQSLTQ-MPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-PYDQ-----SFESRDLLIDEWKSLTYDEVISFVPPP--------
87 PsiBlast_CBE 94.60100%-132 - C1 -4EH3 MK14_HUMAN A:[4-354] ---ERPTFYRQELNKTIWEVPERYQNLSPVGS--YGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLM-GADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLA-------------------VATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPG-AELLKKISSESARNYIQSLTQ-MPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-PYDQ-----SFESRDLLIDEWKSLTYDEVISFVPPPLD------
38 PsiBlast_CBE 94.56100%-133 - C1 -2ZAZ MK14_HUMAN A:[4-352] ---ERPTFYRQELNKTIWEVPERYQNLSPVG----GSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLM-GADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHT-------DD--EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPG-AELLKKISSESARNYIQSLTQ-MPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-PYDQ-----SFESRDLLIDEWKSLTYDEVISFVPPP--------
15 PsiBlast_PDB 94.53100%-130 - C1 -1BL6 MK14_HUMAN A:[23-373] ---ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLM-GADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHT-------DD--EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPG-AELLKKISSESARNYIQSLTQ-MPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-PYDQ-----SFESRDLLIDEWKSLTYDEVISFVPPPLD------
55 PsiBlast_CBE 94.50100%-129 - C1 -3MPT MK14_HUMAN A:[15-363] ---ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLM-GADLNNIVK-CQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGL--HT-------DD--EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPG-AELLKKISSESARNYIQSLTQ-MPKMNFANVFIGA------------NPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVA-D-PYDQ-----SFESRDLLIDEWKSLTYDEVISFVPPP--------