@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : ACVR1_HUMAN: (2015-10-02 )
MVDGVMILPVLIMIALPSPSMEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVGLIILSVVFAVCLLACLLGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC

Atome Classification :

(35 SA) .........10........20........30........40........50........60........70........80........90........100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280.......290.......300.......310.......320......---.330.......340.......350.......360.......370.......380.......390.......400.......410.-....-..420.......430.......440.......450.......460.......470.......480.......490.......500.......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MVDGVMILPVLIMIALPSPSMEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLEVGLIILSVVFAVCLLACLLGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQG---KPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWE-VARR-MVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC
2 PsiBlast_PDB 95.3199%-115 - C1 -4C02 ACVR1_HUMAN A:[9-330] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------STLADLLD----SGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSR--STQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQG---KPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDV---PRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWE-VARR-MVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKID----------
1 PsiBlast_PDB 95.1499%-113 - C1 -3H9R ACVR1_HUMAN A:[3-330] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------TTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTS---STQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQG---KPAIAHRDLKSKNILVKKNGQCCIADLGLAVMH-------------RVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWE-VARR-MVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKID----------
25 PsiBlast_CBE 91.2999%-107 - C1 -3Q4U ACVR1_HUMAN C:[6-301] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------VARDITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQG---KPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWE-VARR-MVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKID----------
22 PsiBlast_CBE 91.2499%-110 - C1 -4BGG ACVR1_HUMAN C:[6-299] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------VARDITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEI----G---KPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTN---VGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWE-VAR---------EDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTK------------
4 PsiBlast_PDB 90.8299%-107 - C1 -3OOM ACVR1_HUMAN A:[5-301] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TVARDITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQG---KPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWE-VARR-MVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKID----------
26 PsiBlast_CBE 90.1399%-111 - C1 -3Q4U ACVR1_HUMAN B:[2-300] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MQRTVARDITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQG---KPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWE-VARR-MVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKI-----------
3 PsiBlast_PDB 90.1399%-107 - C1 -3MTF ACVR1_HUMAN A:[5-300] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TVARDITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQG---KPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWE-VARR-MVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKI-----------
7 PsiBlast_PDB 90.0499%-109 - C1 -4DYM ACVR1_HUMAN A:[9-301] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQG---KPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWE-VARR-MVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKID----------
21 PsiBlast_CBE 89.9399%-109 - C1 -4BGG ACVR1_HUMAN D:[6-300] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------VARDITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMT------QLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFG------KPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWE-VARR-MVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKI-----------
6 PsiBlast_PDB 89.7399%-108 - C1 -4BGG ACVR1_HUMAN A:[5-300] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TVARDITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQG---KPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWE-VARR-MVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKI-----------
88 HHSearch 89.6699%-109 - C1 -3Q4U ACVR1_HUMAN A:[4-301] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RTVARDITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQG---KPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWE-VARR-MVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKID----------
5 PsiBlast_PDB 89.6699%-109 - C1 -3Q4U ACVR1_HUMAN A:[4-301] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RTVARDITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQG---KPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWE-VARR-MVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKID----------
23 PsiBlast_CBE 89.5499%-109 - C1 -4BGG ACVR1_HUMAN B:[5-300] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TVARDITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFG------KPAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWE-VARR-MVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKI-----------
16 PsiBlast_PDB 84.9866%-109 - C1 -2WOU TGFR1_HUMAN A:[3-298] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEIVGTQG---KPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWE-IARR-CSIGGIHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLTALRIKKTLSQLS----------
14 PsiBlast_PDB 84.5266%-106 - C1 -3TZM TGFR1_HUMAN A:[6-301] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEIVGTQG---KPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDTIDIAP--RVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWE-IARR-CSIGGIHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLTALRIKKTLSQLS----------
19 PsiBlast_PDB 84.4466%-106 - C1 -3GXL TGFR1_HUMAN A:[1-295] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------IARTIVLQESIGKGRFGEVWRGKW---EVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEIVGTQG---KPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDTID-----RVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWE-IARR-CSI---HEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNR--SCEALRVMAKIMRECWYANGAARLTALRIKKTLSQLSQQ--------
15 PsiBlast_PDB 84.0166%-107 - C1 -2WOT TGFR1_HUMAN A:[3-298] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEIVGTQG---KPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWE-IARR-CSIGGIHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLTALRIKKTLSQLSQQEG------
20 PsiBlast_PDB 83.6766%-108 - C1 -3HMM TGFR1_HUMAN A:[1-295] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------IARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEIVGTQG---KPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDTIDIA-----GTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWE-IARR-CSIGGIHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLTALRIKKTLSQLSQQ--------
69 PsiBlast_CBE 81.9566%-109 - C1 -4X0M TGFR1_HUMAN A:[2-297] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEIVGTQG---KPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWE-IARR-CSIGGIHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLTALRIKKTLSQLSQQEGI-----
18 PsiBlast_PDB 81.8466%-107 - C1 -1RW8 TGFR1_HUMAN A:[1-296] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEIVGTQG---KPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWE-IARR-CSIGGIHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLTALRIKKTLSQLSQQEG------
13 PsiBlast_PDB 81.6964%-101 - C1 -3MDY BMR1B_HUMAN A:[10-334] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SLRDLIEQSQSSGSGSGLPLLVQRTIAKQIQMVKQIGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDYLKSTTLDAKSMLKLAYSSVSGLCHLHTEIFSTQG---KPAIAHRDLKSKNILVKKNGTCCIADLGLAVKFI---------PNTRVGTKRYMPPEVLDESLNRNHFQSYIMADMYSFGLILWE-VARR-CVSGGIVEEYQLPYHDLVPSDPSYEDMREIVCIKKLRPSFPNRWSSDECLRQMGKLMTECWAHNPASRLTALRVKKTLAKMSESQDIKL---
90 HHSearch 81.5764%-100 * C1 *3MDY BMR1B_HUMAN A:[9-334] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------E-SLRDLIEQSQSSGSGSGLPLLVQRTIAKQIQMVKQIGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDYLKSTTLDAKSMLKLAYSSVSGLCHLHTEIFSTQG---KPAIAHRDLKSKNILVKKNGTCCIADLGLAVKFI---------PNTRVGTKRYMPPEVLDESLNRNHFQSYIMADMYSFGLILWE-VARR-CVSGGIVEEYQLPYHDLVPSDPSYEDMREIVCIKKLRPSFPNRWSSDECLRQMGKLMTECWAHNPASRLTALRVKKTLAKMSESQDIKL---
17 PsiBlast_PDB 81.5266%-107 - C1 -4X2G ? A:[2-297] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TIARTIVLQESIGKGRFGEVWRGKWRGEEVAVKIFSSREERSWFREAEIYQTVMLRHENILGFIAADNKDNGTWTQLWLVSDYHEHGSLFDYLNRYTVTVEGMIKLALSTASGLAHLHMEIVGTQG---KPAIAHRDLKSKNILVKKNGTCCIADLGLAVRHDSATDTIDIAPNHRVGTKRYMAPEVLDDSINMKHFESFKRADIYAMGLVFWE-IARR-CSIGGIHEDYQLPYYDLVPSDPSVEEMRKVVCEQKLRPNIPNRWQSCEALRVMAKIMRECWYANGAARLTALRIKKTLSQLSQQEGI-----
65 PsiBlast_CBE 81.3464%-102 - C1 -3MDY BMR1B_HUMAN C:[10-334] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SLRDLIEQSQSSGSGSGLPLLVQRTIAKQIQMVKQIGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDYLKSTTLDAKSMLKLAYSSVSGLCHLHTEIFSTQG---KPAIAHRDLKSKNILVKKNGTCCIADLGLAVKFI-------IPPNTRVGTKRYMPPEVLDESLNRNHFQSYIMADMYSFGLILWE-VARR-CVSGGIVEEYQLPYHDLVPSDPSYEDMREIVCIKKLRPSFPNRWSSDEC