@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : AURKC_HUMAN: (2015-10-03 )
MSSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEVKIADFGWSVHTPSLRRKTMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSRRVLPPCAQMAS

Atome Classification :

(100 SA) .........10........20........30........40.-.......50........60.---.......70........80-.--.-......90...-...-.-.100.......110.......120.......130.......140.......150.......-160.......170......----.180.......190.--.--.......200.......210.......220.......230.......240---.......250.......----260.......270.......280-----..------.-....290....------...300.......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MSSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDD-FEIGRPLGKGKFGNVYLARL---KESHFIVALKVLFKSQIEK-E--G-LEHQLRREIEI-QAH-L-QHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHD-KKVIHRDIKPENLLLGFRG----EVKIADFGWSVH--T--P--SLRRKTMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFESA---SHSETYRRILKVDVRFP----LSMPLGARDLISRLLRYQPLERL-----PL------A-QILKHPWVQAH------SRRVLPPCAQMAS
5 PsiBlast_PDB 89.9474%-123 - C1 -2VGO AUKBA_XENLA A:[10-278] ------------------------------------KFTIDD-FDIGRPLGKGKFGNVYLARE---KQNKFIMALKVLFKSQLEK-E--G-VEHQLRREIEI-QSH-L-RHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFMEELADALHYCHE-RKVIHRDIKPENLLMGYKG----ELKIADFGWSVH--A--P--SLRRRTMCGTLDYLPPEMIEGKTHDEKVDLWCAGVLCYEFLVGMPPFDSP---SHTETHRRIVNVDLKFP----PFLSDGSKDLISKLLRYHPPQRL-----PL------K-GVMEHPWVKAN------SRRVLPPVY----
26 PsiBlast_CBE 89.3672%-127 - C1 -4B8M AUKBA_XENLA B:[2-280] -----------------------TALAEMPK----RKFTIDD-FDIGRPLGKGKFGNVYLARE---KQNKFIMALKVLFKSQLEK-E--G-VEHQLRREIEI-QSH-L-RHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFMEELADALHYCHE-RKVIHRDIKPENLLMGYKG----ELKIADFGWSVH--A--P--SLRRRTMCGTLDYLPPEMIEGKTHDEKVDLWCAGVLCYEFLVGMPPFDSP---SHTETHRRIVNVDLKFP----PFLSDGSKDLISKLLRYHPPQRL-----PL------K-GVMEHPWVKAN------SRRVLPPVYQS--
21 PsiBlast_CBE 89.1574%-125 - C1 -4C2V AUKBA_XENLA B:[11-281] -----------------------------------RKFTIDD-FDIGRPLGKGKFGNVYLARE---KQNKFIMALKVLFKSQLEK-E--G-VEHQLRREIEI-QSH-L-RHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFMEELADALHYCHE-RKVIHRDIKPENLLMGYKG----ELKIADFGWSVH--A--P--SLRRRTMCGTLDYLPPEMIEGKTHDEKVDLWCAGVLCYEFLVGMPPFDSP---SHTETHRRIVNVDLKFP----PFLSDGSKDLISKLLRYHPPQRL-----PL------K-GVMEHPWVKAN------SRRVLPPVYQ---
24 PsiBlast_CBE 88.2674%-126 - C1 -2VGP AUKBA_XENLA B:[9-278] -----------------------------------RKFTIDD-FDIGRPLGKGKFGNVYLARE---KQNKFIMALKVLFKSQLEK-E--G-VEHQLRREIEI-QSH-L-RHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFMEELADALHYCHE-RKVIHRDIKPENLLMGYKG----ELKIADFGWSVH--A--P--SLRRRTMCGTLDYLPPEMIEGKTHDEKVDLWCAGVLCYEFLVGMPPFDSP---SHTETHRRIVNVDLKFP----PFLSDGSKDLISKLLRYHPPQRL-----PL------K-GVMEHPWVKAN------SRRVLPPVY----
27 PsiBlast_CBE 87.9674%-126 - C1 -4C2W AUKBA_XENLA B:[9-278] -----------------------------------RKFTIDD-FDIGRPLGKGKFGNVYLARE---KQNKFIMALKVLFKSQLEK-E--G-VEHQLRREIEI-QSH-L-RHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFMEELADALHYCHE-RKVIHRDIKPENLLMGYKG----ELKIADFGWSVH--A--P--SLRRRTMCGTLDYLPPEMIEGKTHDEKVDLWCAGVLCYEFLVGMPPFDSP---SHTETHRRIVNVDLKFP----PFLSDGSKDLISKLLRYHPPQRL-----PL------K-GVMEHPWVKAN------SRRVLPPVY----
7 PsiBlast_PDB 87.3074%-121 - C1 -2VRX AUKBA_XENLA A:[11-279] ------------------------------------KFTIDD-FDIGRPLGKGKFGNVYLARE---KQNKFIMALKVLFKSQLEK-E--G-VEHQLRREIEI-QSH-L-RHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFMEELADALHYCHE-RKVIHRDIKPENLLMGYKG----ELKIADFGWSVH--A--P--SLRRRTMCGTLDYLPPEMIEGKTHDEKVDLWCAGVLCYEFLVGMPPFDSP---SHTETHRRIVNVDLKFP----PFLSDGSKDLISKLLRYHPPQRL-----PL------K-GVMEHPWVKAN------SRRVLPPVY----
36 PsiBlast_CBE 87.2871%-126 - C1 -2XNG AURKA_HUMAN A:[7-269] ------------------------------------QWALED-FEIGRPLGKGKFGNVYLARE---KQSKFILALKVLFKAQLEK-A--G-VEHQLRREVEI-QSH-L-RHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS-KRVIHRDIKPENLLLGSAG----ELKIADFGWSVH--A--------------TLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEAN---TYQETYKRISRVEFTFP----DFVTEGARDLISRLLKHNPSQRP-----ML------R-EVLEHPWITAN------SSKP---------
2 PsiBlast_PDB 87.0074%-121 - C1 -4C2V AUKBA_XENLA A:[12-281] ------------------------------------KFTIDD-FDIGRPLGKGKFGNVYLARE---KQNKFIMALKVLFKSQLEK-E--G-VEHQLRREIEI-QSH-L-RHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFMEELADALHYCHE-RKVIHRDIKPENLLMGYKG----ELKIADFGWSVH--A--P--SLRRRTMCGTLDYLPPEMIEGKTHDEKVDLWCAGVLCYEFLVGMPPFDSP---SHTETHRRIVNVDLKFP----PFLSDGSKDLISKLLRYHPPQRL-----PL------K-GVMEHPWVKAN------SRRVLPPVYQS--
4 PsiBlast_PDB 86.9974%-124 - C1 -2VGP AUKBA_XENLA A:[11-279] -------------------------------------FTIDD-FDIGRPLGKG---NVYLARE---KQNKFIMALKVLFKSQLEK-E--G-VEHQLRREIEI-QSH-L-RHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFMEELADALHYCHE-RKVIHRDIKPENLLMGYKG----ELKIADFGWSVH--A--P--SLRRRTMCGTLDYLPPEMIEGKTHDEKVDLWCAGVLCYEFLVGMPPFDSP---SHTETHRRIVNVDLKFP----PFLSDGSKDLISKLLRYHPPQRL-----PL------K-GVMEHPWVKAN------SRRVLPPVYQ---
110 HHSearch 86.9374%-121 - C1 -4C2V AUKBA_XENLA A:[12-282] ------------------------------------KFTIDD-FDIGRPLGKGKFGNVYLARE---KQNKFIMALKVLFKSQLEK-E--G-VEHQLRREIEI-QSH-L-RHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFMEELADALHYCHE-RKVIHRDIKPENLLMGYKG----ELKIADFGWSVH--A--P--SLRRRTMCGTLDYLPPEMIEGKTHDEKVDLWCAGVLCYEFLVGMPPFDSP---SHTETHRRIVNVDLKFP----PFLSDGSKDLISKLLRYHPPQRL-----PL------K-GVMEHPWVKAN------SRRVLPPVYQS--
6 PsiBlast_PDB 86.5774%-122 - C1 -3ZTX AUKBA_XENLA A:[10-279] ------------------------------------KFTIDD-FDIGRPLGKGKFGNVYLARE---KQNKFIMALKVLFKSQLEK-E--G-VEHQLRREIEI-QSH-L-RHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFMEELADALHYCHE-RKVIHRDIKPENLLMGYKG----ELKIADFGWSVH--A--P--SLRRRTMCGTLDYLPPEMIEGKTHDEKVDLWCAGVLCYEFLVGMPPFDSP---SHTETHRRIVNVDLKFP----PFLSDGSKDLISKLLRYHPPQRL-----PL------K-GVMEHPWVKAN------SRRVLPPVYQ---
30 PsiBlast_CBE 86.4968%-138 - C1 -3EFW AURKA_HUMAN A:[126-388] -----------------------------------RQWALED-FEIGRPLGKGKFGNVYLARE---KQSKFILALKVLFKAQLEK-A--G-VEHQLRREVEI-QSH-L-RHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS-KRVIHRDIKPENLLLGSAG----ELKIADF-----------------------LDYLPPEMIE------KVDLWSLGVLCYEFLVGKPPFEAN---TYQETYKRISRVEFTFP----DFVTEGARDLISRLLKHNPSQRP-----ML------R-EVLEHPWITAN------SS-----------
11 PsiBlast_PDB 86.4774%-119 - C1 -2BFY AUKBA_XENLA A:[9-279] -----------------------------------RKFTIDD-FDIVRPLGKGKFGNVYLARE---KQNKFIMALKVLFKSQLEK-E--G-VEHQLRREIEI-QSH-L-RHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFMEELADALHYCHE-RKVIHRDIKPENLLMGYKG----ELKIADFGWSVH--A--P--SLRRRTMCGTLDYLPPEMIEGKTHDEKVDLWCAGVLCYEFLVGMPPFDSP---SHTETHRRIVNVDLKFP----PFLSDGSKDLISKLLRYHPPQRL-----PL------K-GVMEHPWVKAN------SRRVLPPVYQS--
10 PsiBlast_PDB 86.2174%-120 - C1 -4C2W AUKBA_XENLA A:[11-279] -------------------------------------FTIDD-FDIGRPLGKGKFGNVYLARE---KQNKFIMALKVLFKSQLEK-E--G-VEHQLRREIEI-QSH-L-RHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFMEELADALHYCHE-RKVIHRDIKPENLLMGYKG----ELKIADFGWSVH--A--P--SLRRRTMCGTLDYLPPEMIEGKTHDEKVDLWCAGVLCYEFLVGMPPFDSP---SHTETHRRIVNVDLKFP----PFLSDGSKDLISKLLRYHPPQRL-----PL------K-GVMEHPWVKAN------SRRVLPPVYQ---
8 PsiBlast_PDB 86.1672%-123 - C1 -4B8M AUKBA_XENLA A:[11-280] ------------------------------------KFTIDD-FDIGRPLGKGKFGNVYLARE---KQNKFIMALKVLFKSQLEK-E--G-VEHQLRREIEI-QSH-L-RHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFMEELADALHYCHE-RKVIHRDIKPENLLMGYKG----ELKIADFGWSVH--A--P--SLRRRTMCGTLDYLPPEMIEGKTHDEKVDLWCAGVLCYEFLVGMPPFDSP---SHTETHRRIVNVDLKFP----PFLSDGSKDLISKLLRYHPPQRL-----PL------K-GVMEHPWVKAN------SRRVLPPVYQS--
12 PsiBlast_PDB 85.5572%-124 - C1 -2WTW AURKA_HUMAN A:[10-271] -------------------------------------WALED-FEIGRPLGKGKFGNVYLARE---KQSKFILALKVLFKAQLEK-A--G-VEHQLRREVEI-QSH-L-RHPNILRLYGYFHDATRVYLILEYAPRGEVYKELQKLSKFDEQRTATYITELANALSYCHS-KRVIHRDIKPENLLLGSAG----ELKIADFGWSVH--A--P--S------CGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEAN---TYQETYKRISRVEFTFP----DFVTEGARDLISRLLKHNPSQRP-----ML------R-EVLEHPWITAN------SSK----------
23 PsiBlast_CBE 85.1774%-125 - C1 -2VRX AUKBA_XENLA B:[10-279] -----------------------------------RKFTIDD-FDIGRPLG----GNVYLARE---KQNKFIMALKVLFKSQLEK-E--G-VEHQLRREIEI-QSH-L-RHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFMEELADALHYCHE-RKVIHRDIKPENLLMGYKG----ELKIADFGWSVH--A--P--SLRRRTMCGTLDYLPPEMIEGKTHDEKVDLWCAGVLCYEFLVGMPPFDSP---SHTETHRRIVNVDLKFP----PFLSDGSKDLISKLLRYHPPQRL-----PL------K-GVMEHPWVKAN------SRRVLPPVY----
92 PsiBlast_CBE 85.1570%-128 - C1 -4O0W AURKA_HUMAN A:[5-268] -----------------------------------RQWALED-FEIGRPLGKGKFGNVYLARE---KQSKFILALKVLFKAQLEK-A--G-VEHQLRREVEI-QSH-L-RHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS-KRVIYRDIKPENLLLGSAG----ELKIADFGWSVH--------------LCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEAN---TYQETYKRISRVEFTFP----DFVTEGARDLISRLLKHNPSQRP-----ML------R-EVLEHPWITAN------SSKPS--------
25 PsiBlast_CBE 85.1174%-123 - C1 -2VGO AUKBA_XENLA B:[9-279] -----------------------------------RKFTIDD-FDIGRPLGKGKFGNVYLARE---KQNKFIMALKVLFKSQLEK------VEHQLRREIEI-QSH-L-RHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFMEELADALHYCHE-RKVIHRDIKPENLLMGYKG----ELKIADFGWSVH--A--P--SLRRRTMCGTLDYLPPEMIEGKTHDEKVDLWCAGVLCYEFLVGMPPFDSP---SHTETHRRIVNVDLKFP----PFLSDGSKDLISKLLRYHPPQRL-----PL------K-GVMEHPWVKAN------SRRVLPPVYQS--
79 PsiBlast_CBE 84.9471%-126 - C1 -2W1E AURKA_HUMAN A:[7-269] ------------------------------------QWALED-FEIGRPLGKGKFGNVYLARE---KQSKFILALKVLFKAQLEK-A--G-VEHQLRREVEI-QSH-L-RHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS-KRVIHRDIKPENLLLGSAG----ELKIADFGWSV-----------------GTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEAN---TYQETYKRISRVEFTFP----DFVTEGARDLISRLLKHNPSQRP-----ML------R-EVLEHPWITAN------SSKH---------
100 PsiBlast_CBE 84.8970%-128 - C1 -3H0Y AURKA_HUMAN A:[3-265] -----------------------------------RQWALED-FEIGRPLGKGKFGNVYLARE---KQSKFILALKVLFKAQLEK-A--G-VEHQLRREVEI-QSH-L-RHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS-KRVIHRDIKPENLLLGSAG----ELKIADFGWS-------------------TLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEAN---TYQETYKRISRVEFTFP----DFVTEGARDLISRLLKHNPSQRP-----ML------R-EVLEHPWITAN------SS-----------
28 PsiBlast_CBE 84.8574%-120 - C1 -2BFY AUKBA_XENLA B:[9-279] -----------------------------------RKFTIDD-FDIVRPLGKGKFGNVYLARE---KQNKFIMALKVLFKSQLEK-E--G-VEHQLRREIEI-QSH-L-RHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFMEELADALHYCHE-RKVIHRDIKPENLLMGYKG----ELKIADFGWSVH--A--P--SLRRRTMCGTLDYLPPEMIEGKTHDEKVDLWCAGVLCYEFLVGMPPFDSP---SHTETHRRIVNVDLKFP----PFLSDGSKDLISKLLRYHPPQRL-----PL------K-GVMEHPWVKAN------SRRVLPPVYQS--
60 PsiBlast_CBE 84.8371%-119 - C1 -3UOD AURKA_HUMAN A:[4-267] -----------------------------------RQWALED-FEIGRPLGKGKFGNVYLARE---KQSKFILALKVLFKAQLEK-A--G-VEHQLRREVEI-QSH-L-RHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS-KRVIHRDIKPENLLLGSAG----ELKIADFGWSVH--A--P--SSRRDTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEAN---TYQETYKRISRVEFTFP----DFVTEGARDLISRLLKHNPSQRP-----ML------R-EVLEHPWITAN------SSK----------
22 PsiBlast_CBE 84.7574%-123 - C1 -3ZTX AUKBA_XENLA B:[9-278] -----------------------------------RKFTIDD-FDIGRPLG-----NVYLARE---KQNKFIMALKVLFKSQLEK-E--G-VEHQLRREIEI-QSH-L-RHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFMEELADALHYCHE-RKVIHRDIKPENLLMGYKG----ELKIADFGWSVH--A--P--SLRRRTMCGTLDYLPPEMIEGKTHDEKVDLWCAGVLCYEFLVGMPPFDSP---SHTETHRRIVNVDLKFP----PFLSDGSKDLISKLLRYHPPQRL-----PL------K-GVMEHPWVKAN------SRRVLPPVY----
93 PsiBlast_CBE 84.3970%-131 - C1 -3P9J AURKA_HUMAN A:[3-265] -----------------------------------RQWALED-FEIGRPLGKGKFGNVYLARE---KQSKFILALKVLFKAQLEK-A--G-VEHQLRREVEI-QSH-L-RHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS-KRVIHRDIKPENLLLGSAG----ELKIADFGWSV-----------------GTLDYLPPEMIEG---DEKVDLWSLGVLCYEFLVGKPPFEAN---TYQETYKRISRVEFTFP----DFVTEGARDLISRLLKHNPSQRP-----ML------R-EVLEHPWITAN------SS-----------
90 PsiBlast_CBE 84.3971%-130 - C1 -3O50 AURKA_HUMAN A:[2-264] -----------------------------------RQWALED-FEIGRPLGKGKFGNVYLARE---KQSKFILALKVLFKAQLEK-A--G-VEHQLRREVEI-QSH-L-RHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS-KRVIHRDIKPENLLLGSAG----ELKIADFGW--------------------TLDYLPPEMIE---HDEKVDLWSLGVLCYEFLVGKPPFEAN---TYQETYKRISRVEFTFP----DFVTEGARDLISRLLKHNPSQRP-----ML------R-EVLEHPWITAN------SS-----------
76 PsiBlast_CBE 84.3770%-121 - C1 -5AAF ? A:[8-270] -----------------------------------RQWALED-FEIGRPLGKGKFGNVYLARE---KQSKFILALKVLFKAQLEK-A--G-VEHQLRREVEI-QSH-L-RHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS-KRVIHRDIKPENLLLGSAG----ELKIADFGWSVH--A-------------GTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEAN---TYQETYKRISRVEFTFP----DFVTEGARDLISRLLKHNPSQRP-----ML------R-EVLEHPWITAN------SS-----------
78 PsiBlast_CBE 84.1970%-130 - C1 -5AAD ? A:[9-270] ------------------------------------QWALED-FEIGRPLGKGKFGNVYLARE---KQSKFILALKVLFKAQLEK-A--G-VEHQLRREVEI-QSH-L-RHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS-KRVIHRDIKPENLLLGSAG----ELKIADFGWSVH--A--------------TLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEAN---TYQETYKRISRVEFTFP----DFVTEGARDLISRLLKHNPSQRP-----ML------R-EVLEHPWITAN------SS-----------
85 PsiBlast_CBE 83.9970%-138 - C1 -2X81 AURKA_HUMAN A:[8-269] ------------------------------------QWALED-FEIGRPLG---FGNVYLARE---KQSKFILALKVLFKAQLEK-A--G-VEHQLRREVEI-QSH-L-RHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS-KRVIHRDIKPENLLLGSAG----ELKIA-----------------------GTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEAN---TYQETYKRISRVEFTFP----DFVTEGARDLISRLLKHNPSQRP-----ML------R-EVLEHPWITAN------SS-----------
80 PsiBlast_CBE 83.9871%-126 - C1 -2W1D AURKA_HUMAN A:[7-269] ------------------------------------QWALED-FEIGRPLGKGKFGNVYLARE---KQSKFILALKVLFKAQLEK-A--G-VEHQLRREVEI-QSH-L-RHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS-KRVIHRDIKPENLLLGSAG----ELKIADFGWSV-----------------GTLDYLPPEMIEGRMHD-KVDLWSLGVLCYEFLVGKPPFEAN---TYQETYKRISRVEFTFP----DFVTEGARDLISRLLKHNPSQRP-----ML------R-EVLEHPWITAN------SSKH---------
45 PsiBlast_CBE 83.7171%-132 - C1 -3W16 AURKA_HUMAN A:[1-263] -----------------------------------RQWALED-FEIGRPLGKGKFGNVYLARE---KQSKFILALKVLFKAQLEK-A--G-VEHQLRREVEI-QSH-L-RHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS-KRVIHRDIKPENLLLGSAG----ELKIADFGWSV-----------------GTLDYLPPEMIEG---DEKVDLWSLGVLCYEFLVGKPPFEAN---TYQETYKRISRVEFTFP----DFVTEGARDLISRLLKHNPSQRP-----ML------R-EVLEHPWITAN------SS-----------
16 PsiBlast_PDB 83.5070%-124 - C1 -3DJ7 AURKA_MOUSE A:[7-269] -----------------------------------RQWTLED-FDIGRPLGKGKFGNVYLARE---RQSKFILALKVLFKTQLEK-A--G-VEHQLRREVEI-QSH-L-RHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSRFDEQRTATYITELANALSYCHS-KRVIHRDIKPENLLLGSNG----ELKIADFGWSVH--A--P--S------CGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGMPPFEAH---TYQETYRRISRVEFTFP----DFVTEGARDLISRLLKHNASQRL-----TL------A-EVLEHPWIKAN------SS-----------
1 PsiBlast_PDB 83.3084%-125 - C1 -4AF3 AURKB_HUMAN A:[18-286] -----------------------------------RHFTIDD-FEIGRPLGKGKFGNVYLARE---KKSHFIVALKVLFKSQIEK-E--G-VEHQLRREIEI-QAH-L-HHPNILRLYNYFYDRRRIYLILEYAPRGELYKELQKSCTFDEQRTATIMEELADALMYCHG-KKVIHRDIKPENLLLGLKG----ELKIADFG----------------------LDYLPPEMIEGRMHNEKVDLWCIGVLCYELLVGNPPFESA---SHNETYRRIVKVDLKFP----ASVPTGAQDLISKLLRHNPSERL-----PL------A-QVSAHPWVRAN------SRRVLPPS-----
41 PsiBlast_CBE 83.0771%-121 - C1 -4UZD AURKA_HUMAN B:[3-266] -----------------------------------RQWALED-FEIGRPLGKGKFGNVYLARE---KQSKFILALKVLFKAQLEK-A--G-VEHQLRREVEI-QSH-L-RHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS-KRVIHRDIKPENLLLGSAG----ELKIADFGW-------------RRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEAN---TYQETYKRISRVEFTFP----DFVTEGARDLISRLLKHNPSQRP-----ML------R-EVLEHPWITAN------SSK----------
9 PsiBlast_PDB 82.7772%-127 - C1 -4B8L AUKBA_XENLA A:[11-275] ------------------------------------KFTIDD-FDIGRPLGKGKFGNVYLARE---KQNKFIMALKVLFKSQLEK-E--G-VEHQLRREIEI-QSH-L-RHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFMEELADALHYCHE-RKVIHRDIKPENLLMGYKG----ELKIADF----------------------TLDYLPPEMIEGKTHDEKVDLWCAGVLCYEFLVGMPPFDSP---SHTETHRRIVNVDLKFP----PFLSDGSKDLISKLLRYHPPQRL-----PL------K-GVMEHPWVKAN------SRRVL--------
17 PsiBlast_PDB 82.5970%-125 - C1 -3D15 AURKA_MOUSE A:[7-269] -----------------------------------RQWTLED-FDIGRPLGKGKFGNVYLARE---RQSKFILALKVLFKTQLEK-A--G-VEHQLRREVEI-QSH-L-RHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSRFDEQRTATYITELANALSYCHS-KRVIHRDIKPENLLLGSNG----ELKIADFGWSVH--A--P--S-------GTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGMPPFEAH---TYQETYRRISRVEFTFP----DFVTEGARDLISRLLKHNASQRL-----TL------A-EVLEHPWIKAN------SS-----------
32 PsiBlast_CBE 82.5871%-126 - C1 -4BYJ AURKA_HUMAN A:[8-270] -----------------------------------RQWALED-FEIGRPLGKGKFGNVYLARE---KQSKFILALKVLFKAQLEK-A--G-VEHQLRREVEI-QSH-L-RHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS-KRVIHRDIKPENLLLGSAG----ELKIAD-----------------------TLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEAN---TYQETYKRISRVEFTFP----DFVTEGARDLISRLLKHNPSQRP-----ML------R-EVLEHPWITAN------SS-----------
99 PsiBlast_CBE 82.5370%-128 - C1 -3H0Z AURKA_HUMAN A:[5-265] -------------------------------------WALED-FEIGRPLGKGKFGNVYLARE---KQSKFILALKVLFKAQLEK-A--G-VEHQLRREVEI-QSH-L-RHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS-KRVIHRDIKPENLLLGSAG----ELKIADFGWS-------------------TLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEAN---TYQETYKRISRVEFTFP----DFVTEGARDLISRLLKHNPSQRP-----ML------R-EVLEHPWITAN------SS-----------
61 PsiBlast_CBE 82.5271%-117 - C1 -3UO6 AURKA_HUMAN B:[4-267] -----------------------------------RQWALED-FEIGRPLGKGKFGNVYLARE---KQSKFILALKVLFKAQLEK-A--G-VEHQLRREVEI-QSH-L-RHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS-KRVIHRDIKPENLLLGSAG----ELKIADFGWSVH--A--P--SSRRDTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEAN---TYQETYKRISRVEFTFP----DFVTEGARDLISRLLKHNPSQRP-----ML------R-EVLEHPWITAN------SSK----------
96 PsiBlast_CBE 82.3170%-116 - C1 -3H10 AURKA_HUMAN A:[1-266] ---------------------------------AKRQWALED-FEIGRPLGKGKFGNVYLARE---KQSKFILALKVLFKAQLEK-A--G-VEHQLRREVEI-QSH-L-RHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS-KRVIHRDIKPENLLLGSAG----ELKIADFGWSVH--A--P--SSRRAALCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEAN---TYQETYKRISRVEFTFP----DFVTEGARDLISRLLKHNPSQRP-----ML------R-EVLEHPWITAN------SSKPS--------
31 PsiBlast_CBE 82.2968%-122 - C1 -2J4Z AURKA_HUMAN B:[29-292] -----------------------------------RQWALED-FEIGRPLGKGKFGNVYLARE---KQSKFILALKVLFKAQLEK-A--G-VEHQLRREVEI-QSH-L-RHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS-KRVIHRDIKPENLLLGSAG----ELKIADFGWSVH--A--P--SSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEAN---TYQETYKRISRVEFTFP----DFVTEGARDLISRLLKHNPSQRP-----ML------R-EVLEHPWITAN------SSKPSNCQN----
84 PsiBlast_CBE 82.2670%-127 - C1 -3MYG AURKA_HUMAN A:[7-269] -----------------------------------RQWALED-FEIGRPLGKGKFGNVYLARE---KQSKFILALKVLFKAQLEK-A--G-VEHQLRREVEI-QSH-L-RHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS-KRVIHRDIKPENLLLGSAG----ELKIADFGWSVH-----------------TLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEAN---TYQETYKRISRVEFTFP----DFVTEGARDLISRLLKHNPSQRP-----ML------R-EVLEHPWITAN------SS-----------
77 PsiBlast_CBE 82.1370%-125 - C1 -5AAE ? A:[8-270] -----------------------------------RQWALED-FEIGRPLGKGKFGNVYLARE---KQSKFILALKVLFKAQLEK-A--G-VEHQLRREVEI-QSH-L-RHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS-KRVIHRDIKPENLLLGSAG----ELKIADFGWSV-----------------GTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEAN---TYQETYKRISRVEFTFP----DFVTEGARDLISRLLKHNPSQRP-----ML------R-EVLEHPWITAN------SS-----------
75 PsiBlast_CBE 82.0770%-126 - C1 -5AAG ? A:[9-270] ------------------------------------QWALED-FEIGRPLGKGKFGNVYLARE---KQSKFILALKVLFKAQLEK-A--G-VEHQLRREVEI-QSH-L-RHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS-KRVIHRDIKPENLLLGSAG----ELKIADFGWSVH--A-------------GTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEAN---TYQETYKRISRVEFTFP----DFVTEGARDLISRLLKHNPSQRP-----ML------R-EVLEHPWITAN------SS-----------
33 PsiBlast_CBE 81.9971%-124 - C1 -4BYI AURKA_HUMAN A:[8-270] -----------------------------------RQWALED-FEIGRPLGKGKFGNVYLARE---KQSKFILALKVLFKAQLEK-A--G-VEHQLRREVEI-QSH-L-RHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS-KRVIHRDIKPENLLLGSAG----ELKIADFGWSVH--A-------------GTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEAN---TYQETYKRISRVEFTFP----DFVTEGARDLISRLLKHNPSQRP-----ML------R-EVLEHPWITAN------SS-----------
42 PsiBlast_CBE 81.9771%-124 - C1 -4UZD AURKA_HUMAN A:[4-265] ------------------------------------QWALED-FEIGRPLGKGKFGNVYLARE---KQSKFILALKVLFKAQLEK-A--G-VEHQLRREVEI-QSH-L-RHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS-KRVIHRDIKPENLLLGSAG----ELKIADFG--------------RRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEAN---TYQETYKRISRVEFTFP----DFVTEGARDLISRLLKHNPSQRP-----ML------R-EVLEHPWITAN------SS-----------
29 PsiBlast_CBE 81.9768%-131 - C1 -3EFW AURKA_HUMAN B:[126-389] -----------------------------------RQWALED-FEIGRPLGKGKFGNVYLARE---KQSKFILALKVLFKAQLEK-A--G-VEHQLRREVEI-QSH-L-RHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS-KRVIHRDIKPENLLLGSAG----ELKIADF-----------------------LDYLPPEMIE-----EKVDLWSLGVLCYEFLVGKPPFEAN---TYQETYKRISRVEFTFP----DFVTEGARDLISRLLKHNPSQRP-----ML------R-EVLEHPWITAN------SSK----------
54 PsiBlast_CBE 81.8871%-118 - C1 -3UOK AURKA_HUMAN B:[4-267] -----------------------------------RQWALED-FEIGRPLGKGKFGNVYLARE---KQSKFILALKVLFKAQLEK-A--G-VEHQLRREVEI-QSH-L-RHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS-KRVIHRDIKPENLLLGSAG----ELKIADFGWSVH--A--P--SSRRDTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEAN---TYQETYKRISRVEFTFP----DFVTEGARDLISRLLKHNPSQRP-----ML------R-EVLEHPWITAN------SSK----------
59 PsiBlast_CBE 81.8571%-117 - C1 -3UOH AURKA_HUMAN A:[4-267] -----------------------------------RQWALED-FEIGRPLGKGKFGNVYLARE---KQSKFILALKVLFKAQLEK-A--G-VEHQLRREVEI-QSH-L-RHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS-KRVIHRDIKPENLLLGSAG----ELKIADFGWSVH--A--P--SSRRDTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEAN---TYQETYKRISRVEFTFP----DFVTEGARDLISRLLKHNPSQRP-----ML------R-EVLEHPWITAN------SSK----------
87 PsiBlast_CBE 81.8170%-122 - C1 -1MQ4 AURKA_HUMAN A:[7-269] -----------------------------------RQWALED-FEIGRPLGKGKFGNVYLARE---KQSKFILALKVLFKAQLEK-A--G-VEHQLRREVEI-QSH-L-RHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS-KRVIHRDIKPENLLLGSAG----ELKIADFGWSVH--A--P--SSR--TLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEAN---TYQETYKRISRVEFTFP----DFVTEGARDLISRLLKHNPSQRP-----ML------R-EVLEHPWITAN------SS-----------
55 PsiBlast_CBE 81.7171%-119 - C1 -3UOK AURKA_HUMAN A:[4-267] -----------------------------------RQWALED-FEIGRPLGKGKFGNVYLARE---KQSKFILALKVLFKAQLEK-A--G-VEHQLRREVEI-QSH-L-RHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS-KRVIHRDIKPENLLLGSAG----ELKIADFGWSVH--A--P--SSRRDTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEAN---TYQETYKRISRVEFTFP----DFVTEGARDLISRLLKHNPSQRP-----ML------R-EVLEHPWITAN------SSK----------
88 PsiBlast_CBE 81.6971%-134 - C1 -3O51 AURKA_HUMAN A:[2-264] -----------------------------------RQWALED-FEIGRPLGKGKFGNVYLARE---KQSKFILALKVLFKAQLEK-A--G-VEHQLRREVEI-QSH-L-RHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS-KRVIHRDIKPENLLLGSAG----ELKIADF-----------------------LDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEAN---TYQETYKRISRVEFTFP----DFVTEGARDLISRLLKHNPSQRP-----ML------R-EVLEHPWITAN------SS-----------
18 PsiBlast_PDB 81.6270%-127 - C1 -3D2I AURKA_MOUSE A:[8-269] ------------------------------------QWTLED-FDIGRPLGKGKFGNVYLARE---RQSKFILALKVLFKTQLEK-A--G-VEHQLRREVEI-QSH-L-RHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSRFDEQRTATYITELANALSYCHS-KRVIHRDIKPENLLLGSNG----ELKIADFGWSVH--A--P---------CGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGMPPFEAH---TYQETYRRISRVEFTFP----DFVTEGARDLISRLLKHNASQRL-----TL------A-EVLEHPWIKAN------SS-----------
62 PsiBlast_CBE 81.6171%-116 - C1 -3UO6 AURKA_HUMAN A:[4-267] -----------------------------------RQWALED-FEIGRPLGKGKFGNVYLARE---KQSKFILALKVLFKAQLEK-A--G-VEHQLRREVEI-QSH-L-RHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS-KRVIHRDIKPENLLLGSAG----ELKIADFGWSVH--A--P--SSRRDTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEAN---TYQETYKRISRVEFTFP----DFVTEGARDLISRLLKHNPSQRP-----ML------R-EVLEHPWITAN------SSK----------
58 PsiBlast_CBE 81.4371%-118 - C1 -3UOH AURKA_HUMAN B:[4-267] -----------------------------------RQWALED-FEIGRPLGKGKFGNVYLARE---KQSKFILALKVLFKAQLEK-A--G-VEHQLRREVEI-QSH-L-RHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHS-KRVIHRDIKPENLLLGSAG----ELKIADFGWSVH--A--P--SSRRDTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEAN---TYQETYKRISRVEFTFP----DFVTEGARDLISRLLKHNPSQRP-----ML------R-EVLEHPWITAN------SSK----------