@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : CDK17_HUMAN: (2015-10-04 )
MKKFKRRLSLTLRGSQTIDESLSELAEQMTIEENSSKDNEPIVKNGRPPTSHSMHSFLHQYTGSFKKPPLRRPHSVIGGSLGSFMAMPRNGSRLDIVHENLKMGSDGESDQASGTSSDEVQSPTGVCLRNRIHRRISMEDLNKRLSLPADIRIPDGYLEKLQINSPPFDQPMSRRSRRASLSEIGFGKMETYIKLEKLGEGTYATVYKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIVHTDKSLTLVFEYLDKDLKQYMDDCGNIMSMHNVKLFLYQILRGLAYCHRRKVLHRDLKPQNLLINEKGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSSEYSTQIDMWGVGCIFFEMASGRPLFPGSTVEDELHLIFRLLGTPSQETWPGISSNEEFKNYNFPKYKPQPLINHAPRLDSEGIELITKFLQYESKKRVSAEEAMKHVYFRSLGPRIHALPESVSIFSLKEIQLQKDPGFRNSSYPETGHGKNRRQSMLF

Atome Classification :

(102 SA) .........10........20........30........40........50........60........70........80........90........100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210--.......220....-..-.-230.......240.......250.....--.-----.------260-----........270.......280-.---.-.---......290.......300.......310.......320---..-.-.....330.......--340.......350.......360.......370.......380.-.-.....390..----.....400.......410.......420----..--.--....430-.-.-------..----.-.-.440........450.......460.......470.......480.....---..490.......500-.......510.......520.
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MKKFKRRLSLTLRGSQTIDESLSELAEQMTIEENSSKDNEPIVKNGRPPTSHSMHSFLHQYTGSFKKPPLRRPHSVIGGSLGSFMAMPRNGSRLDIVHENLKMGSDGESDQASGTSSDEVQSPTGVCLRNRIHRRISMEDLNKRLSLPADIRIPDGYLEKLQINSPPFDQPMSRRSRRASLSEIGFGKMETYIKLEKLGEGTYATVYKGRSK--LTENLVALKEIRLE-HE-E-GAPCTAIREVSLLKDLKHANIVTLHDIV--H-----T------DK------SLTLVFEYLDKDLKQYMDD---C---G-N---IMSMHNVKLFLYQILRGLAYCHRRKVLHRDLKPQNLLI----NE-K-GELKLADFGLARAKS--VPTKTYSNEVVTLWYRPPDVLLGSSEYSTQIDMWGVGCIFFEMA-S-GRPLFPGSTV----EDELHLIFRLLGTPSQETWPGISSNEEF----KN--Y--NFPKYKP-Q-P-------LI----N-H-APR-LDSEGIELITKFLQYESKKRVSAEEAMKHVYFRSLGPRIHALPESV---SIFSLKEIQLQKDPG-FRNSSYPETGHGKNRRQSMLF
41 PsiBlast_CBE 83.9853%-114 - C1 -3RM7 CDK2_HUMAN A:[9-297] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDY----KP-----SFPKWAR-Q-D-------FS----K-V-VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
42 PsiBlast_CBE 82.9753%-111 - C1 -3RM6 CDK2_HUMAN A:[9-297] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGT-GVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDY----KP-----SFPKWAR-Q-D-------FS----K-V-VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
100 PsiBlast_CBE 82.8853%-111 - C1 -3QQF CDK2_HUMAN A:[9-297] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDY----KP-----SFPKWAR-Q-D-------FS----K-V-VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
73 PsiBlast_CBE 82.6953%-112 - C1 -3R1S CDK2_HUMAN A:[9-297] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDY----KP-----SFPKWAR-Q-D-------FS----K-V-VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
74 PsiBlast_CBE 82.6853%-109 - C1 -3R1Q CDK2_HUMAN A:[9-297] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDY----KP-----SFPKWAR-Q-D-------FS----K-V-VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
83 PsiBlast_CBE 82.4153%-112 - C1 -3QWK CDK2_HUMAN A:[9-297] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDY----KP-----SFPKWAR-Q-D-------FS----K-V-VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
38 PsiBlast_CBE 82.3353%-109 - C1 -3ROY CDK2_HUMAN A:[9-297] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDY----KP-----SFPKWAR-Q-D-------FS----K-V-VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
69 PsiBlast_CBE 82.3053%-110 - C1 -3R71 CDK2_HUMAN A:[9-297] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDY----KP-----SFPKWAR-Q-D-------FS----K-V-VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
76 PsiBlast_CBE 82.2653%-111 - C1 -3QZH CDK2_HUMAN A:[9-297] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDY----KP-----SFPKWAR-Q-D-------FS----K-V-VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
81 PsiBlast_CBE 82.1853%-112 - C1 -3QX4 CDK2_HUMAN A:[9-297] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDY----KP-----SFPKWAR-Q-D-------FS----K-V-VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
94 PsiBlast_CBE 82.1653%-112 - C1 -3QRT CDK2_HUMAN A:[9-297] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDY----KP-----SFPKWAR-Q-D-------FS----K-V-VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
80 PsiBlast_CBE 82.0053%-111 - C1 -3QXO CDK2_HUMAN A:[9-297] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDY----KP-----SFPKWAR-Q-D-------FS----K-V-VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
67 PsiBlast_CBE 81.9453%-113 - C1 -3R7E CDK2_HUMAN A:[9-297] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDY----KP-----SFPKWAR-Q-D-------FS----K-V-VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
75 PsiBlast_CBE 81.7453%-110 - C1 -3QZI CDK2_HUMAN A:[9-297] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDY----KP-----SFPKWAR-Q-D-------FS----K-V-VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
71 PsiBlast_CBE 81.6653%-109 - C1 -3R28 CDK2_HUMAN A:[9-297] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDY----KP-----SFPKWAR-Q-D-------FS----K-V-VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
95 PsiBlast_CBE 81.6353%-111 - C1 -3QQL CDK2_HUMAN A:[9-297] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDY----KP-----SFPKWAR-Q-D-------FS----K-V-VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
39 PsiBlast_CBE 81.4953%-110 - C1 -3RNI CDK2_HUMAN A:[9-297] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDY----KP-----SFPKWAR-Q-D-------FS----K-V-VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
61 PsiBlast_CBE 81.4853%-115 - C1 -3R8L CDK2_HUMAN A:[9-297] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDY----KP-----SFPKWAR-Q-D-------FS----K-V-VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
68 PsiBlast_CBE 81.3453%-109 - C1 -3R73 CDK2_HUMAN A:[9-297] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDY----KP-----SFPKWAR-Q-D-------FS----K-V-VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
77 PsiBlast_CBE 81.2553%-115 - C1 -3QZG CDK2_HUMAN A:[9-297] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDY----KP-----SFPKWAR-Q-D-------FS----K-V-VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
78 PsiBlast_CBE 81.2453%-109 - C1 -3QZF CDK2_HUMAN A:[9-297] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDY----KP-----SFPKWAR-Q-D-------FS----K-V-VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
37 PsiBlast_CBE 81.2053%-110 - C1 -3RPO CDK2_HUMAN A:[9-297] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDY----KP-----SFPKWAR-Q-D-------FS----K-V-VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
46 PsiBlast_CBE 81.1553%-110 - C1 -3RK5 CDK2_HUMAN A:[9-297] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDY----KP-----SFPKWAR-Q-D-------FS----K-V-VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
72 PsiBlast_CBE 81.1253%-110 - C1 -3R1Y CDK2_HUMAN A:[9-297] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDY----KP-----SFPKWAR-Q-D-------FS----K-V-VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
84 PsiBlast_CBE 81.0953%-109 - C1 -3QWJ CDK2_HUMAN A:[9-297] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDY----KP-----SFPKWAR-Q-D-------FS----K-V-VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
32 PsiBlast_CBE 81.0853%-113 - C1 -3S00 CDK2_HUMAN A:[9-297] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDY----KP-----SFPKWAR-Q-D-------FS----K-V-VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
50 PsiBlast_CBE 81.0753%-109 - C1 -3RAI CDK2_HUMAN A:[9-297] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDY----KP-----SFPKWAR-Q-D-------FS----K-V-VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
54 PsiBlast_CBE 81.0653%-112 - C1 -3R9H CDK2_HUMAN A:[9-297] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDY----KP-----SFPKWAR-Q-D-------FS----K-V-VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
101 PsiBlast_CBE 81.0453%-108 - C1 -3QL8 CDK2_HUMAN A:[9-297] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDY----KP-----SFPKWAR-Q-D-------FS----K-V-VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
93 PsiBlast_CBE 80.9753%-108 - C1 -3QRU CDK2_HUMAN A:[9-297] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIRL----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDY----KP-----SFPKWAR-Q-D-------FS----K-V-VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
70 PsiBlast_CBE 80.9653%-109 - C1 -3R6X CDK2_HUMAN A:[9-297] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDY----KP-----SFPKWAR-Q-D-------FS----K-V-VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
59 PsiBlast_CBE 80.8353%-111 - C1 -3R8P CDK2_HUMAN A:[9-297] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDY----KP-----SFPKWAR-Q-D-------FS----K-V-VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
44 PsiBlast_CBE 80.7953%-109 - C1 -3RK9 CDK2_HUMAN A:[9-297] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDY----KP-----SFPKWAR-Q-D-------FS----K-V-VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
20 PsiBlast_PDB 80.7853%-105 - C1 -1OI9 CDK2_HUMAN A:[4-293] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SMENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIRL--TETE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDY----KP-----SFPKWAR-Q-D-------FS----K-V-VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHL--------------------------------------------
43 PsiBlast_CBE 80.7753%-110 - C1 -3RKB CDK2_HUMAN A:[9-297] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDY----KP-----SFPKWAR-Q-D-------FS----K-V-VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
96 PsiBlast_CBE 80.7453%-109 - C1 -3QQK CDK2_HUMAN A:[9-297] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDY----KP-----SFPKWAR-Q-D-------FS----K-V-VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
66 PsiBlast_CBE 80.6953%-114 - C1 -3R7I CDK2_HUMAN A:[9-297] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR----------PSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--V--------VVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDY----KP-----SFPKWAR-Q-D-------FS----K-V-VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
58 PsiBlast_CBE 80.6953%-110 - C1 -3R8U CDK2_HUMAN A:[9-297] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQD