@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : CDK18_HUMAN: (2015-10-04 )
MNKMKNFKRRFSLSVPRTETIEESLAEFTEQFNQLHNRRNENLQLGPLGRDPPQECSTFSPTDSGEEPGQLSPGVQFQRRQNQRRFSMEDVSKRLSLPMDIRLPQEFLQKLQMESPDLPKPLSRMSRRASLSDIGFGKLETYVKLDKLGEGTYATVFKGRSKLTENLVALKEIRLEHEEGAPCTAIREVSLLKNLKHANIVTLHDLIHTDRSLTLVFEYLDSDLKQYLDHCGNLMSMHNVKIFMFQLLRGLAYCHHRKILHRDLKPQNLLINERGELKLADFGLARAKSVPTKTYSNEVVTLWYRPPDVLLGSTEYSTPIDMWGVGCIHYEMATGRPLFPGSTVKEELHLIFRLLGTPTEETWPGVTAFSEFRTYSFPCYLPQPLINHAPRLDTDGIHLLSSLLLYESKSRMSAEAALSHSYFRSLGERVHQLEDTASIFSLKEIQLQKDPGYRGLAFQQPGRGKNRRQSIF

Atome Classification :

(99 SA) .........10........20........30........40........50........60........70........80........90........100.......110.......120.......130.......140.......150.......160--.......170....-..-.-180.......190.......200.....--.-----.------210-----........220.......230-.---.-.---......240.......250.......260.......270---..-.-.....280.......--290.......300.......310.......320.......330.-.-.....340..----.....350.......360.......370.----..--....380-..-..----...-.-390........400.......410.......420.......430....-.---..440.......450-.......460.......470
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MNKMKNFKRRFSLSVPRTETIEESLAEFTEQFNQLHNRRNENLQLGPLGRDPPQECSTFSPTDSGEEPGQLSPGVQFQRRQNQRRFSMEDVSKRLSLPMDIRLPQEFLQKLQMESPDLPKPLSRMSRRASLSDIGFGKLETYVKLDKLGEGTYATVFKGRSK--LTENLVALKEIRLE-HE-E-GAPCTAIREVSLLKNLKHANIVTLHDLI--H-----T------DR------SLTLVFEYLDSDLKQYLDH---C---G-N---LMSMHNVKIFMFQLLRGLAYCHHRKILHRDLKPQNLLI----NE-R-GELKLADFGLARAKS--VPTKTYSNEVVTLWYRPPDVLLGSTEYSTPIDMWGVGCIHYEMA-T-GRPLFPGSTV----KEELHLIFRLLGTPTEETWPGVTAFSEFR----TY--SFPCY-L-PQ-PL----INH-A-PR-LDTDGIHLLSSLLLYESKSRMSAEAALSHSYFRSLGERVHQLEDT-A---SIFSLKEIQLQKDPG-YRGLAFQQPGRGKNRRQSIF
13 PsiBlast_PDB 86.4953%-101 - C1 -1OGU CDK2_HUMAN A:[2-300] ---------------------------------------------------------------------------------------------------------------------------------------PGSMENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIRL----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDYK----P---SFPKW-A-RQ-DF----SKV-V-PP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLR-------------------------------------------
82 PsiBlast_CBE 86.4853%-111 - C1 -2VTS CDK2_HUMAN A:[1-296] ------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR----------PSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAF----------HEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDYK----P---SFPKW-A-RQ-DF----SKV-V-PP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
25 PsiBlast_CBE 86.2853%-109 - C1 -5A14 ? A:[2-297] ------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIRLD---TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG------------VTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDYK----P---SFPKW-A-RQ-DF----SKV-V-PP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHL--------------------------------------------
46 PsiBlast_CBE 85.9753%-110 - C1 -3WBL CDK2_HUMAN A:[1-296] ------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK---TGEVVALKKIRL-------GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG-----------VVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDYK----P---SFPKW-A-RQ-DF----SKV-V-PP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
96 PsiBlast_CBE 85.8853%-113 - C1 -2UZN CDK2_HUMAN A:[1-296] ------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKI-----------PSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAF------------VVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDYK----P---SFPKW-A-RQ-DF----SKV-V-PP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
123 HHSearch 85.8657%-108 - C1 -4AU8 CDK5_HUMAN A:[6-293] -------------------------------------------------------------------------------------------------------------------------------------------QKYEKLEKIGEGTYGTVFKAKNR--ETHEIVALKRV-----------PSSALREICLLKELKHKNIVRLHDVL--H--------------------KLTLVFEFCDQDLKKYFDS---C---N-G---DLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLI----NR-N-GELKLADFGLARAFG--IPVR--SAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELA-NAGRPLFPGNDV----DDQLKRIFRLLGTPTEEQWPSMTKLPDYK----P----YPMY-P-ATTSL----VNV-V-PK-LNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDF---------------------------------------------------
70 PsiBlast_CBE 85.7653%-109 - C1 -2XNB CDK2_HUMAN A:[1-296] ------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIRLD---TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDYK----P---SFPKW-A-RQ-DF----SKV-V-PP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
86 PsiBlast_CBE 85.7553%-111 - C1 -2VTO CDK2_HUMAN A:[1-296] ------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR---------VPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAF----------HEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDYK----P---SFPKW-A-RQ-DF----SKV-V-PP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
15 PsiBlast_PDB 85.6753%-104 - C1 -1OIU CDK2_HUMAN A:[2-300] ---------------------------------------------------------------------------------------------------------------------------------------PGSMENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIRL----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDYK----P---SFPKW-A-RQ-DF----SKV-V-PP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLR-------------------------------------------
57 PsiBlast_CBE 85.6553%-109 - C1 -3LFS CDK2_HUMAN A:[1-296] ------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR----------PSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDYK----P---SFPKW-A-RQ-DF----SKV-V-PP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
67 PsiBlast_CBE 85.6053%-103 - C1 -3EJ1 CDK2_HUMAN C:[1-296] ------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIRL----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDYK----P---SFPKW-A-RQ-DF----SKV-V-PP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLR-------------------------------------------
12 PsiBlast_PDB 85.6053%-111 - C1 -3EZV CDK2_HUMAN A:[3-298] ------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR---------VPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGL----------------VVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDYK----P---SFPKW-A-RQ-DF----SKV-V-PP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
49 PsiBlast_CBE 85.5753%-112 - C1 -3ULI CDK2_HUMAN A:[1-296] ------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIRLD-------VPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--V-------EVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDYK----P---SFPKW-A-RQ-DF----SKV-V-PP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
95 PsiBlast_CBE 85.5153%-108 - C1 -2UZO CDK2_HUMAN A:[1-296] ------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIRL--------VPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDYK----P---SFPKW-A-RQ-DF----SKV-V-PP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHL--------------------------------------------
16 PsiBlast_PDB 85.4053%-101 - C1 -1OIY CDK2_HUMAN A:[4-300] -----------------------------------------------------------------------------------------------------------------------------------------SMENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIRL----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDYK----P---SFPKW-A-RQ-DF----SKV-V-PP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHL--------------------------------------------
78 PsiBlast_CBE 85.3853%-109 - C1 -2W06 CDK2_HUMAN A:[1-296] ------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR---------VPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAF-----------EVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDYK----P---SFPKW-A-RQ-DF----SKV-V-PP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
50 PsiBlast_CBE 85.3353%-110 - C1 -3TIZ CDK2_HUMAN A:[2-296] -------------------------------------------------------------------------------------------------------------------------------------------ENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDYK----P---SFPKW-A-RQ-DF----SKV-V-PP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
71 PsiBlast_CBE 85.2653%-108 - C1 -2XMY CDK2_HUMAN A:[1-296] ------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIRLD-T----GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDYK----P---SFPKW-A-RQ-DF----SKV-V-PP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
2 PsiBlast_PDB 85.1957%-109 - C1 -4AU8 CDK5_HUMAN A:[6-290] -------------------------------------------------------------------------------------------------------------------------------------------QKYEKLEKIGEGTYGTVFKAKNR--ETHEIVALKRV-----------PSSALREICLLKELKHKNIVRLHDVL--H--------------------KLTLVFEFCDQDLKKYFDS---C---N-G---DLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLI----NR-N-GELKLADFGLARAFG--IPVR--SAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANA-GRPLFPGNDV----DDQLKRIFRLLGTPTEEQWPSMTKLPDYK----PY----PMYPA-TT-SL----VNV-V-PK-LNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDF---------------------------------------------------
56 PsiBlast_CBE 85.1553%-111 - C1 -3NS9 CDK2_HUMAN A:[3-296] --------------------------------------------------------------------------------------------------------------------------------------------NFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKI---------GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDYK----P---SFPKW-A-RQ-DF----SKV-V-PP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
94 PsiBlast_CBE 85.0953%-109 - C1 -2V0D CDK2_HUMAN A:[1-296] ------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIRL--------VPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDYK----P---SFPKW-A-RQ-DF----SKV-V-PP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
59 PsiBlast_CBE 85.0953%-115 - C1 -3LFN CDK2_HUMAN A:[1-296] ------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARA-----------HEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDYK----P---SFPKW-A-RQ-DF----SKV-V-PP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
68 PsiBlast_CBE 85.0853%-104 - C1 -3EJ1 CDK2_HUMAN A:[1-296] ------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIRL----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDYK----P---SFPKW-A-RQ-DF----SKV-V-PP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
17 PsiBlast_PDB 85.0853%-103 - C1 -4CFN CDK2_HUMAN A:[2-300] ---------------------------------------------------------------------------------------------------------------------------------------PGSMENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIRL----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDYK----P---SFPKW-A-RQ-DF----SKV-V-PP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLR-------------------------------------------
51 PsiBlast_CBE 85.0453%-113 - C1 -3TIY CDK2_HUMAN A:[2-296] -------------------------------------------------------------------------------------------------------------------------------------------ENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDYK----P---SFPKW-A-RQ-DF----SKV-V-PP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
14 PsiBlast_PDB 85.0453%-104 - C1 -1OI9 CDK2_HUMAN A:[4-300] -----------------------------------------------------------------------------------------------------------------------------------------SMENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIRL--TETE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDYK----P---SFPKW-A-RQ-DF----SKV-V-PP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHL--------------------------------------------
44 PsiBlast_CBE 85.0153%-115 - C1 -4BZD CDK2_HUMAN A:[2-297] ------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEG-YGVVYKARNK--LTGEVVALKKIRL--------VPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGL----------------VVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDYK----P---SFPKW-A-RQ-DF----SKV-V-PP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
93 PsiBlast_CBE 84.9653%-112 - C1 -2VTA CDK2_HUMAN A:[1-296] ------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----------STAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAF-------------VTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDYK----P---SFPKW-A-RQ-DF----SKV-V-PP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
48 PsiBlast_CBE 84.9553%-109 - C1 -3UNJ CDK2_HUMAN A:[1-296] ------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDYK----P---SFPKW-A-RQ-DF----SKV-V-PP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
10 PsiBlast_PDB 84.9553%-103 - C1 -2IW8 CDK2_HUMAN A:[4-300] -----------------------------------------------------------------------------------------------------------------------------------------SMENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIRLD-TETE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEHVDQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDYK----P---SFPKW-A-RQ-DF----SKV-V-PP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLR-------------------------------------------
92 PsiBlast_CBE 84.9453%-113 - C1 -2VTH CDK2_HUMAN A:[1-296] ------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----------STAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAF-------------VTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDYK----P---SFPKW-A-RQ-DF----SKV-V-PP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
45 PsiBlast_CBE 84.8053%-117 - C1 -4BGH CDK2_HUMAN A:[1-296] ------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKI-----------PSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLA----------------VTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDYK----P---SFPKW-A-RQ-DF----SKV-V-PP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
20 PsiBlast_PDB 84.8053%-103 - C1 -1H1P CDK2_HUMAN A:[5-301] -----------------------------------------------------------------------------------------------------------------------------------------SMENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIRLD-TETE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDYK----P---SFPKW-A-RQ-DF----SKV-V-PP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHL--------------------------------------------
18 PsiBlast_PDB 84.7953%-100 - C1 -4EOS CDK2_HUMAN A:[2-299] ----------------------------------------------------------------------------------------------------------------------------------------GSMENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIRLD----E-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDYK----P---SFPKW-A-RQ-DF----SKV-V-PP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLR-------------------------------------------
79 PsiBlast_CBE 84.7653%-117 - C1 -2W05 CDK2_HUMAN A:[1-296] ------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----------STAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGL---------------EVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDYK----P---SFPKW-A-RQ-DF----SKV-V-PP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
52 PsiBlast_CBE 84.7053%-112 - C1 -3TI1 CDK2_HUMAN A:[1-296] ------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR-----TE-GVPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG--VPVRTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDYK----P---SFPKW-A-RQ-DF----SKV-V-PP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
43 PsiBlast_CBE 84.7053%-112 - C1 -4D1X CDK2_HUMAN A:[3-296] --------------------------------------------------------------------------------------------------------------------------------------------NFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKI-------------TAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAFG-------------TLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDYK----P---SFPKW-A-RQ-DF----SKV-V-PP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
11 PsiBlast_PDB 84.7053%-115 - C1 -3EZR CDK2_HUMAN A:[3-298] ------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKIR---------VPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADF--------------------TLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVTSMPDYK----P---SFPKW-A-RQ-DF----SKV-V-PP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL------------------------------------------
91 PsiBlast_CBE 84.6953%-115 - C1 -2VTI CDK2_HUMAN A:[1-296] ------------------------------------------------------------------------------------------------------------------------------------------MENFQKVEKIGEGTYGVVYKARNK--LTGEVVALKKI----------VPSTAIREISLLKELNHPNIVKLLDVI--H-----T------EN------KLYLVFEFLHQDLKKFMDA---S---ALT---GIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NT-E-GAIKLADFGLARAF------------VVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMV-T-RRALFPGDSE----IDQLFRIFRTLGTPDEVV