@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : CDK5_HUMAN: (2015-10-05 )
MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLINRNGELKLADFGLARAFGIPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP

Atome Classification :

(98 SA) .........10........20....--....30........40........50........60........70-..------.-----.------.....80........90..---.----.-....100........110.......120.......130..----.-....140.......150..-.----....160.......170.......180.......190.....----------..200.....-------.----.210.......220.......230--.--.--..-.-.----.-240.........250----...-.....260.......270.......280.......290
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MQKYEKLEKIGEGTYGTVFKAKNRE--THEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVL--HS------D-----K------KLTLVFEFCDQDLKKYFDS---C----N-GDLDP-EIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLI----N-RNGELKLADFGLARAFGIP-V----RCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELAN----------AGRPLFPGND-------V----DDQLKRIFRLLGTPTEEQWPSMTK--L--P--DY-K-P----Y-P--MYPATTSLVN-V----VPK-LNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
3 PsiBlast_PDB 94.0699%-115 - C1 -1UNL CDK5_HUMAN A:[1-292] MQKYEKLEKIGEGTYGTVFKAKNRE--THEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVL--HS------D-----K------KLTLVFEFCDQDLKKYFDS---C----N-GDLDP-EIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLI----N-RNGELKLANFGLARAFGIP-V----RCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELAN----------AGRPLFPGND-------V----DDQLKRIFRLLGTPTEEQWPSMTK--L--P--DY-K-P----Y-P--MYPATTSLVN-V----VPK-LNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
1 PsiBlast_PDB 93.6999%-119 - C1 -1UNG CDK5_HUMAN A:[1-292] MQKYEKLEKI----YGTVFKAKNRE--THEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVL--HS------D-----K------KLTLVFEFCDQDLKKYFDS---C----N-GDLDP-EIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLI----N-RNGELKLANFGLARAFGIP-V----RCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELAN----------AGRPLFPGND-------V----DDQLKRIFRLLGTPTEEQWPSMTK--L--P--DY-K-P----Y-P--MYPATTSLVN-V----VPK-LNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDFCPP
23 PsiBlast_CBE 93.38100%-116 - C1 -4AU8 CDK5_HUMAN B:[6-293] -QKYEKLEKIGEGTYGTVFKAKNRE--THEIVALKRVRL----EGVPSSALREICLLKELKHKNIVRLHDVL--HS------------K------KLTLVFEFCDQDLKKYFDS---C----N-GDLDP-EIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLI----N-RNGELKLADFGLARAFGIP-V----------VVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELAN----------AGRPLFPGND-------V----DDQLKRIFRLLGTPTEEQWPSMTK--L--P--DY-K-P----Y-P--MYPATTSLVN-V----VPK-LNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDF---
112 HHSearch 93.07100%-113 - C1 -4AU8 CDK5_HUMAN A:[6-293] -QKYEKLEKIGEGTYGTVFKAKNRE--THEIVALKRV---------PSSALREICLLKELKHKNIVRLHDVL--H--------------------KLTLVFEFCDQDLKKYFDS---C----N-GDLDP-EIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLI----N-RNGELKLADFGLARAFGIP-V----R--SAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELAN----------AGRPLFPGND-------V----DDQLKRIFRLLGTPTEEQWPSMTK--L--P--DY-K-P----Y-P--MYPATTSLVN-V----VPK-LNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDF---
6 PsiBlast_PDB 93.07100%-113 - C1 -4AU8 CDK5_HUMAN A:[6-293] -QKYEKLEKIGEGTYGTVFKAKNRE--THEIVALKRV---------PSSALREICLLKELKHKNIVRLHDVL--H--------------------KLTLVFEFCDQDLKKYFDS---C----N-GDLDP-EIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLI----N-RNGELKLADFGLARAFGIP-V----R--SAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELAN----------AGRPLFPGND-------V----DDQLKRIFRLLGTPTEEQWPSMTK--L--P--DY-K-P----Y-P--MYPATTSLVN-V----VPK-LNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDF---
21 PsiBlast_CBE 91.4499%-125 - C1 -3O0G CDK5_HUMAN B:[6-288] -----KLEKIG-----TVFKA--------EIVALKRVR--------PSSALREICLLKELKHKNIVRLHDVL--HS------D-----K------KLTLVFEFCDQDLKKYFDS---C----N-GDLDP-EIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLI----N-RNGELKLANFGLARAFGIP-V----RCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELAN----------AGRPLFPGND-------V----DDQLKRIFRLLGTPTEEQWPSMTK--L--P--DY-K-P----Y-P--MYPATTSLVN-V----VPK-LNATGRDLLQNLLKCNPVQRISAEEALQHPYFSD----
94 PsiBlast_CBE 84.6359%-113 - C1 -2VTA CDK2_HUMAN A:[1-292] MENFQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR---------STAIREISLLKELNHPNIVKLLDVI--HT------E-----N------KLYLVFEFLHQDLKKFMDA---S----A-LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----N-TEGAIKLADFGLARAF----------------VTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT----------R-RALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVTS--M--P--DY-K-PS---F-P--KW-ARQDFSK-V----VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP
48 PsiBlast_CBE 84.2659%-113 - C1 -3WBL CDK2_HUMAN A:[1-292] MENFQKVEKIGEGTYGVVYKARNK---TGEVVALKKIRL-----GVPSTAIREISLLKELNHPNIVKLLDVI--HT------E-----N------KLYLVFEFLHQDLKKFMDA---S----A-LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----N-TEGAIKLADFGLARAFG--------------VVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT----------R-RALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVTS--M--P--DY-K-PS---F-P--KW-ARQDFSK-V----VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP
51 PsiBlast_CBE 84.1759%-116 - C1 -3ULI CDK2_HUMAN A:[1-292] MENFQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIRLD-----VPSTAIREISLLKELNHPNIVKLLDVI--HT------E-----N------KLYLVFEFLHQDLKKFMDA---S----A-LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----N-TEGAIKLADFGLARAFGV------------EVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT----------R-RALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVTS--M--P--DY-K-PS---F-P--KW-ARQDFSK-V----VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP
83 PsiBlast_CBE 84.1559%-115 - C1 -2VTS CDK2_HUMAN A:[1-292] MENFQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR--------PSTAIREISLLKELNHPNIVKLLDVI--HT------E-----N------KLYLVFEFLHQDLKKFMDA---S----A-LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----N-TEGAIKLADFGLARAF-------------HEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT----------R-RALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVTS--M--P--DY-K-PS---F-P--KW-ARQDFSK-V----VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP
79 PsiBlast_CBE 84.0559%-114 - C1 -2W06 CDK2_HUMAN A:[1-292] MENFQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR-------VPSTAIREISLLKELNHPNIVKLLDVI--HT------E-----N------KLYLVFEFLHQDLKKFMDA---S----A-LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----N-TEGAIKLADFGLARAF--------------EVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT----------R-RALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVTS--M--P--DY-K-PS---F-P--KW-ARQDFSK-V----VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP
18 PsiBlast_PDB 84.0159%-115 - C1 -1FVT CDK2_HUMAN A:[1-292] MENFQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR-------VPSTAIREISLLKELNHPNIVKLLDVI--HT------E-----N------KLYLVFEFLHQDLKKFMDA---S----A-LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----N-TEGAIKLADFGLARAFG--------------VVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT----------R-RALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVTS--M--P--DY-K-PS---F-P--KW-ARQDFSK-V----VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP
71 PsiBlast_CBE 83.9059%-114 - C1 -2XNB CDK2_HUMAN A:[1-292] MENFQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIRLD--TEGVPSTAIREISLLKELNHPNIVKLLDVI--HT------E-----N------KLYLVFEFLHQDLKKFMDA---S----A-LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----N-TEGAIKLADFGLARAFGVP-V----RTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT----------R-RALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVTS--M--P--DY-K-PS---F-P--KW-ARQDFSK-V----VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP
59 PsiBlast_CBE 83.7459%-117 - C1 -3LFS CDK2_HUMAN A:[1-292] MENFQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR--------PSTAIREISLLKELNHPNIVKLLDVI--HT------E-----N------KLYLVFEFLHQDLKKFMDA---S----A-LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----N-TEGAIKLADFGLARAFGVP-V----RTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT----------R-RALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVTS--M--P--DY-K-PS---F-P--KW-ARQDFSK-V----VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP
14 PsiBlast_PDB 83.5459%-118 - C1 -1CKP CDK2_HUMAN A:[1-292] MENFQKVEKIGEGTYGVVYKARNKL--TGEVVALKKI--------VPSTAIREISLLKELNHPNIVKLLDVI--HT------E-----N------KLYLVFEFLHQDLKKFMDA---S----A-LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----N-TEGAIKLADFGLARAF----------------VTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT----------R-RALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVTS--M--P--DY-K-PS---F-P--KW-ARQDFSK-V----VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP
64 PsiBlast_CBE 83.4959%-112 - C1 -3FZ1 CDK2_HUMAN A:[1-292] MENFQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR-------VPSTAIREISLLKELNHPNIVKLLDVI--HT------E-----N------KLYLVFEFLHQDLKKFMDA---S----A-LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----N-TEGAIKLADFGLARAFG------------HEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT----------R-RALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVTS--M--P--DY-K-PS---F-P--KW-ARQDFSK-V----VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP
72 PsiBlast_CBE 83.4159%-114 - C1 -2XMY CDK2_HUMAN A:[1-292] MENFQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIRLDT---GVPSTAIREISLLKELNHPNIVKLLDVI--HT------E-----N------KLYLVFEFLHQDLKKFMDA---S----A-LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----N-TEGAIKLADFGLARAFGVP-V----RTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT----------R-RALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVTS--M--P--DY-K-PS---F-P--KW-ARQDFSK-V----VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP
52 PsiBlast_CBE 83.3659%-117 - C1 -3TIZ CDK2_HUMAN A:[2-292] -ENFQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVI--HT------E-----N------KLYLVFEFLHQDLKKFMDA---S----A-LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----N-TEGAIKLADFGLARAFGVP-V----RTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT----------R-RALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVTS--M--P--DY-K-PS---F-P--KW-ARQDFSK-V----VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP
90 PsiBlast_CBE 83.2759%-113 - C1 -2VTL CDK2_HUMAN A:[1-292] MENFQKVEKIGEGTYGVVYKARNKL--TGEVVALKKI--------VPSTAIREISLLKELNHPNIVKLLDVI--HT------E-----N------KLYLVFEFLHQDLKKFMDA---S----A-LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----N-TEGAIKLADFGLARAFGVP-V----RTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT----------R-RALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVTS--M--P--DY-K-PS---F-P--KW-ARQDFSK-V----VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP
53 PsiBlast_CBE 83.1659%-116 - C1 -3TIY CDK2_HUMAN A:[2-292] -ENFQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVI--HT------E-----N------KLYLVFEFLHQDLKKFMDA---S----A-LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----N-TEGAIKLADFGLARAFGVP-V----RTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT----------R-RALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVTS--M--P--DY-K-PS---F-P--KW-ARQDFSK-V----VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP
61 PsiBlast_CBE 83.1559%-114 - C1 -3LFN CDK2_HUMAN A:[1-292] MENFQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVI--HT------E-----N------KLYLVFEFLHQDLKKFMDA---S----A-LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----N-TEGAIKLADFGLARA--------------HEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT----------R-RALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVTS--M--P--DY-K-PS---F-P--KW-ARQDFSK-V----VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP
10 PsiBlast_PDB 83.1460%-113 - C1 -1V0P CDC2H_PLAFK A:[1-286] MEKYHGLEKIGEGTYGVVYKAQNN---YGETFALKKIRLEKEDEGIPSTTIREISILKELKHSNIVKLYDVI--HT------K-----K------RLVLVFEHLDQDLKKLLDV---C----E-GGLES-VTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLI----N-REGELKIADFGLARAFG--------------IVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVN-----------GTPLFPGVS-------E----ADQLMRIFRILGTPNSKNWPNVTE--L--P--KY-D-P----N-F--TVYEPLPWES-F----LKG-LDESGIDLLSKMLKLDPNQRITAKQALEHAYFKE----
77 PsiBlast_CBE 83.1059%-112 - C1 -2W1H CDK2_HUMAN A:[1-292] MENFQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVI--HT------E-----N------KLYLVFEFLHQDLKKFMDA---S----A-LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----N-TEGAIKLADFGLARAF----------------VTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT----------R-RALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVTS--M--P--DY-K-PS---F-P--KW-ARQDFSK-V----VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP
16 PsiBlast_PDB 83.1059%-115 - C1 -1DI8 CDK2_HUMAN A:[1-292] MENFQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR------GVPSTAIREISLLKELNHPNIVKLLDVI--HT------E-----N------KLYLVFEFLHQDLKKFMDA---S----A-LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----N-TEGAIKLADFGLARAF--------------EVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT----------R-RALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVTS--M--P--DY-K-PS---F-P--KW-ARQDFSK-V----VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP
93 PsiBlast_CBE 83.0359%-116 - C1 -2VTH CDK2_HUMAN A:[1-292] MENFQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR---------STAIREISLLKELNHPNIVKLLDVI--HT------E-----N------KLYLVFEFLHQDLKKFMDA---S----A-LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----N-TEGAIKLADFGLARAF----------------VTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT----------R-RALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVTS--M--P--DY-K-PS---F-P--KW-ARQDFSK-V----VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP
58 PsiBlast_CBE 82.9159%-118 - C1 -3NS9 CDK2_HUMAN A:[3-292] --NFQKVEKIGEGTYGVVYKARNKL--TGEVVALKKI-------GVPSTAIREISLLKELNHPNIVKLLDVI--HT------E-----N------KLYLVFEFLHQDLKKFMDA---S----A-LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----N-TEGAIKLADFGLARAFGVP-V----RTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT----------R-RALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVTS--M--P--DY-K-PS---F-P--KW-ARQDFSK-V----VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP
100 PsiBlast_CBE 82.8559%-118 - C1 -2R64 CDK2_HUMAN A:[1-292] MENFQKVEKIGEGTYGVVYKARNKL--TGEVVALKKI--------VPSTAIREISLLKELNHPNIVKLLDVI--HT------E-----N------KLYLVFEFLHQDLKKFMDA---S----A-LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----N-TEGAIKLADFGLARAF----------------VTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT----------R-RALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVTS--M--P--DY-K-PS---F-P--KW-ARQDFSK-V----VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP
87 PsiBlast_CBE 82.8559%-113 - C1 -2VTO CDK2_HUMAN A:[1-292] MENFQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR-------VPSTAIREISLLKELNHPNIVKLLDVI--HT------E-----N------KLYLVFEFLHQDLKKFMDA---S----A-LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----N-TEGAIKLADFGLARAF-------------HEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT----------R-RALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVTS--M--P--DY-K-PS---F-P--KW-ARQDFSK-V----VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP
84 PsiBlast_CBE 82.8459%-113 - C1 -2VTR CDK2_HUMAN A:[1-292] MENFQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR--------PSTAIREISLLKELNHPNIVKLLDVI--HT------E-----N------KLYLVFEFLHQDLKKFMDA---S----A-LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----N-TEGAIKLADFGLARAFGVP-V----RTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT----------R-RALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVTS--M--P--DY-K-PS---F-P--KW-ARQDFSK-V----VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP
45 PsiBlast_CBE 82.7959%-117 - C1 -4D1X CDK2_HUMAN A:[3-292] --NFQKVEKIGEGTYGVVYKARNKL--TGEVVALKKI-----------TAIREISLLKELNHPNIVKLLDVI--HT------E-----N------KLYLVFEFLHQDLKKFMDA---S----A-LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----N-TEGAIKLADFGLARAFG----------------TLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT----------R-RALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVTS--M--P--DY-K-PS---F-P--KW-ARQDFSK-V----VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP
96 PsiBlast_CBE 82.7759%-116 - C1 -2UZO CDK2_HUMAN A:[1-292] MENFQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIRL------VPSTAIREISLLKELNHPNIVKLLDVI--HT------E-----N------KLYLVFEFLHQDLKKFMDA---S----A-LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----N-TEGAIKLADFGLARAFGVP-V----RTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT----------R-RALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVTS--M--P--DY-K-PS---F-P--KW-ARQDFSK-V----VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP
57 PsiBlast_CBE 82.7159%-115 - C1 -3S2P CDK2_HUMAN A:[1-292] MENFQKVEKIGEGTYGVVYKARNKL--TGEVVALKKI--------VPSTAIREISLLKELNHPNIVKLLDVI--HT------E-----N------KLYLVFEFLHQDLKKFMDA---S----A-LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----N-TEGAIKLADFGLARAF----------------VTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT----------R-RALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVTS--M--P--DY-K-PS---F-P--KW-ARQDFSK-V----VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP
28 PsiBlast_CBE 82.7159%-110 - C1 -4LYN CDK2_HUMAN A:[1-292] MENFQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIRLDTETEGVPSTAIREISLLKELNHPNIVKLLDVI--HT------E-----N------KLYLVFEFLHQDLKKFMDA---S----A-LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----N-TEGAIKLADFGLARAF----------------VTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT----------R-RALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVTS--M--P--DY-K-PS---F-P--KW-ARQDFSK-V----VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP
89 PsiBlast_CBE 82.6959%-115 - C1 -2VTM CDK2_HUMAN A:[1-292] MENFQKVEKIGEGTYGVVYKARNKL--TGEVVALKKI--------VPSTAIREISLLKELNHPNIVKLLDVI--HT------E-----N------KLYLVFEFLHQDLKKFMDA---S----A-LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----N-TEGAIKLADFGLARAFGVP-V----RTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT----------R-RALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVTS--M--P--DY-K-PS---F-P--KW-ARQDFSK-V----VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP
47 PsiBlast_CBE 82.5359%-116 - C1 -4BGH CDK2_HUMAN A:[1-292] MENFQKVEKIGEGTYGVVYKARNKL--TGEVVALKKI---------PSTAIREISLLKELNHPNIVKLLDVI--HT------E-----N------KLYLVFEFLHQDLKKFMDA---S----A-LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----N-TEGAIKLADFGLA-------------------VTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT----------R-RALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVTS--M--P--DY-K-PS---F-P--KW-ARQDFSK-V----VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP
60 PsiBlast_CBE 82.4759%-118 - C1 -3LFQ CDK2_HUMAN A:[1-292] MENFQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR---------STAIREISLLKELNHPNIVKLLDVI--HT------E-----N------KLYLVFEFLHQDLKKFMDA---S----A-LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----N-TEGAIKLADFGLARAFGVP-V----RTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT----------R-RALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVTS--M--P--DY-K-PS---F-P--KW-ARQDFSK-V----VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP
11 PsiBlast_PDB 82.4559%-114 - C1 -3EZR CDK2_HUMAN A:[3-294] MENFQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR-------VPSTAIREISLLKELNHPNIVKLLDVI--HT------E-----N------KLYLVFEFLHQDLKKFMDA---S----A-LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----N-TEGAIKLADF-----------------------TLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT----------R-RALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVTS--M--P--DY-K-PS---F-P--KW-ARQDFSK-V----VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP
95 PsiBlast_CBE 82.4459%-116 - C1 -2V0D CDK2_HUMAN A:[1-292] MENFQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIRL------VPSTAIREISLLKELNHPNIVKLLDVI--HT------E-----N------KLYLVFEFLHQDLKKFMDA---S----A-LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----N-TEGAIKLADFGLARAFGVP-V----RTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT----------R-RALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVTS--M--P--DY-K-PS---F-P--KW-ARQDFSK-V----VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP
92 PsiBlast_CBE 82.3359%-117 - C1 -2VTI CDK2_HUMAN A:[1-292] MENFQKVEKIGEGTYGVVYKARNKL--TGEVVALKKI--------VPSTAIREISLLKELNHPNIVKLLDVI--HT------E-----N------KLYLVFEFLHQDLKKFMDA---S----A-LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----N-TEGAIKLADFGLARAF---------------VVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT----------R-RALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVTS--M--P--DY-K-PS---F-P--KW-ARQDFSK-V----VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP
86 PsiBlast_CBE 82.3259%-116 - C1 -2VTP CDK2_HUMAN A:[1-292] MENFQKVEKIGEGTYGVVYKARNKL--TGEVVALKKI--------VPSTAIREISLLKELNHPNIVKLLDVI--HT------E-----N------KLYLVFEFLHQDLKKFMDA---S----A-LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----N-TEGAIKLADFGLARAF--------------EVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT----------R-RALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVTS--M--P--DY-K-PS---F-P--KW-ARQDFSK-V----VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP
80 PsiBlast_CBE 82.2959%-115 - C1 -2W05 CDK2_HUMAN A:[1-292] MENFQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR---------STAIREISLLKELNHPNIVKLLDVI--HT------E-----N------KLYLVFEFLHQDLKKFMDA---S----A-LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----N-TEGAIKLADFGL------------------EVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT----------R-RALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVTS--M--P--DY-K-PS---F-P--KW-ARQDFSK-V----VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP
12 PsiBlast_PDB 82.2259%-108 - C1 -3EZV CDK2_HUMAN A:[3-294] MENFQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR-------VPSTAIREISLLKELNHPNIVKLLDVI--HT------E-----N------KLYLVFEFLHQDLKKFMDA---S----A-LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----N-TEGAIKLADFGL-------------------VVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT----------R-RALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVTS--M--P--DY-K-PS---F-P--KW-ARQDFSK-V----VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP
69 PsiBlast_CBE 82.1759%-112 - C1 -3EJ1 CDK2_HUMAN C:[1-292] MENFQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIRL---TEGVPSTAIREISLLKELNHPNIVKLLDVI--HT------E-----N------KLYLVFEFLHQDLKKFMDA---S----A-LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----N-TEGAIKLADFGLARAFGVP-V----RTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT----------R-RALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVTS--M--P--DY-K-PS---F-P--KW-ARQDFSK-V----VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP
97 PsiBlast_CBE 82.1659%-116 - C1 -2UZN CDK2_HUMAN A:[1-292] MENFQKVEKIGEGTYGVVYKARNKL--TGEVVALKKI---------PSTAIREISLLKELNHPNIVKLLDVI--HT------E-----N------KLYLVFEFLHQDLKKFMDA---S----A-LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----N-TEGAIKLADFGLARAF---------------VVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT----------R-RALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVTS--M--P--DY-K-PS---F-P--KW-ARQDFSK-V----VPP-LDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKP
54 PsiBlast_CBE 81.7459%-114 - C1 -3TI1 CDK2_HUMAN A:[1-292] MENFQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVI--HT------E-----N------KLYLVFEFLHQDLKKFMDA---S----A-LTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----N-TEGAIKLADFGLARAFGVP-V----RTYTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT----------R-RALFPGDS-------E----IDQLFRIFRTLGTPDEVVWPGVTS--M--P--DY-K-PS---F-P--KW-ARQDFSK-V----VPP-LDEDGRSLLSQMLHYDPNKRISAK