@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : CDK9_HUMAN: (2015-10-05 )
MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRKTGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTKASPYNRCKGSIYLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLITRDGVLKLADFGLARAFSLAKNSQPNRYTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWTRSPIMQGNTEQHQLALISQLCGSITPEVWPNVDNYELYEKLELVKGQKRKVKDRLKAYVRDPYALDLIDKLLVLDPAQRIDSDDALNHDFFWSDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF

Atome Classification :

(97 SA) .........10........20........30........40-.........50........60........70........80.......--.90........100.......110..-.------...-.120.--......130.......140.......150.....----..160.......170.......180..-.....190.......200.......210.......220..-..-...230..----.....240.......250.....-------..260...---.--...270-.-.--......280.-.......290.......300.......310...----.--...320.......330.......340.......350.......360.......370
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MAKQYDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRK--TGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTK--ASPYNRCKGSIYLVFDFCEHDLAGLL-S------NVL-VKFTL--SEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLI----TRDGVLKLADFGLARAFSLAKNSQPNR-YTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWT-RS-PIMQGNTE----QHQLALISQLCGSITPEVWPNVD-------NYELYEKL---E--LVKGQ--K-R--KVKDRLKA-Y-VRDPYALDLIDKLLVLDPAQRIDSDDALNHDFF----W--SDPMPSDLKGMLSTHLTSMFEYLAPPRRKGSQITQQSTNQSRNPATTNQTEFERVF
13 PsiBlast_PDB 95.6199%-131 - C1 -4BCG CDK9_HUMAN A:[8-328] ------SVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRK--TGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRT----------KGSIYLVFDFCEHDLAGLL-S------NVL-VKFTL--SEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLI----TRDGVLKLADFGLARAFSLAKNSQPNR-YTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWT-RS-PIMQGNTE----QHQLALISQLCGSITPEVWPNVD-------NYELYEKL---E--LVKGQ--K-R--KVKDRLKA-Y-VRDPYALDLIDKLLVLDPAQRIDSDDALNHDFF----W--SDPMPSDLKGM---------------------------------------------
5 PsiBlast_PDB 94.6599%-136 - C1 -3BLQ CDK9_HUMAN A:[8-326] ------SVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRK--TGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRT------------SIYLVFDFCEHDLAGLL-S------NVL-VKFTL--SEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLI----TRDGVLKLADFGLARAFS-------NR-YTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWT-RS-PIMQGNTE----QHQLALISQLCGSITPEVWPNVD-------NYELYEKL---E--LV-----------VKDRLKA-Y-VRDPYALDLIDKLLVLDPAQRIDSDDALNHDFF----W--SDPMPSDLK-----------------------------------------------
4 PsiBlast_PDB 93.6399%-125 - C1 -3MIA CDK9_HUMAN A:[8-340] -------VECPFCDEVSKYEKLAKIGQGTFGEVFKARHRK--TGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRT----------KGSIYLVFDFCEHDLAGLL-S------NVL-VKFTL--SEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLI----TRDGVLKLADFGLARAFSLAKNSQPNR-YTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWT-RS-PIMQGNTE----QHQLALISQLCGSITPEVWPNVD-------NYELYEKL---E--LVKGQ--K-R--KVKDRLKA-Y-VRDPYALDLIDKLLVLDPAQRIDSDDALNHDFF----W--SDPMPSDLKGMLSTHLTSMFEYLA--------------------------------
9 PsiBlast_PDB 92.4099%-136 - C1 -3TNH CDK9_HUMAN A:[9-329] -------VECPFCDEVSKYEKLAKIGQGTFGEVFKARHRK--TGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRT------------SIYLVFDFCEHDLAGLL-S------NVL-VKFTL--SEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLI----TRDGVLKLADFGLARAFS-------NR-YTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWT-RS-PIMQGNTE----QHQLALISQLCGSITPEVWPNVD-------N-------------------------KVKDRLKA-Y-VRDPYALDLIDKLLVLDPAQRIDSDDALNHDFF----W--SDPMPSDLKGML--------------------------------------------
11 PsiBlast_PDB 91.8599%-127 - C1 -4BCI CDK9_HUMAN A:[6-327] ----YDSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRK--TGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRT-----------GSIYLVFDFCEHDLAGLL-S------NVL-VKFTL--SEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLI----TRDGVLKLADFGLARAFSLA----PNR-YTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWT-RS-PIMQGNTE----QHQLALISQLCGSITPEVWPNVD-------NYELYEKL---E--LVKGQ--K-R--KVKDRLKA-Y-VRDPYALDLIDKLLVLDPAQRIDSDDALNHDFF----W--SDPMPSDLKG----------------------------------------------
6 PsiBlast_PDB 91.8499%-128 - C1 -3BLR CDK9_HUMAN A:[8-327] ------SVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRK--TGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRT------------SIYLVFDFCEHDLAGLL-S------NVL-VKFTL--SEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLI----TRDGVLKLADFGLARAFSLA----PNR-YTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWT-RS-PIMQGNTE----QHQLALISQLCGSITPEVWPNVD-------NYELYEKL---E--LVK----------VKDRLKA-Y-VRDPYALDLIDKLLVLDPAQRIDSDDALNHDFF----W--SDPMPSDLKG----------------------------------------------
7 PsiBlast_PDB 91.6099%-123 - C1 -3MY1 CDK9_HUMAN A:[7-328] -----DSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRK--TGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTK---------KGSIYLVFDFCEHDLAGLL-S------NVL-VKFTL--SEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLI----TRDGVLKLADFGLARAFSLAKNSQPNR-YTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWT-RS-PIMQGNTE----QHQLALISQLCGSITPEVWPNVD-------NYELYEKL---E--LVKGQ--K-R--KVKDRLKA-Y-VRDPYALDLIDKLLVLDPAQRIDSDDALNHDFF----W--SDPMPSDLKGM---------------------------------------------
12 PsiBlast_PDB 91.1799%-126 - C1 -4BCJ CDK9_HUMAN A:[7-327] -----DSVECPFCDEVSKYEKLAKIGQGTFGEVFKARHRK--TGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRTK---------KGSIYLVFDFCEHDLAGLL-S------NVL-VKFTL--SEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLI----TRDGVLKLADFGLARAFSLA----PNR-YTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWT-RS-PIMQGNTE----QHQLALISQLCGSITPEVWPNVD-------NYELYEKL---E--LVKGQ--K-R--KVKDRLKA-Y-VRDPYALDLIDKLLVLDPAQRIDSDDALNHDFF----W--SDPMPSDLKG----------------------------------------------
8 PsiBlast_PDB 91.0599%-129 - C1 -3LQ5 CDK9_HUMAN A:[7-328] -----DSVECPFCDEVSKYEKLAKIGQ--FGEVFKARHRK--TGQKVALKKVLMENEKEGFPITALREIKILQLLKHENVVNLIEICRT----------KGSIYLVFDFCEHDLAGLL-S------NVL-VKFTL--SEIKRVMQMLLNGLYYIHRNKILHRDMKAANVLI----TRDGVLKLADFGLARAFSLA----PNR-YTNRVVTLWYRPPELLLGERDYGPPIDLWGAGCIMAEMWT-RS-PIMQGNTE----QHQLALISQLCGSITPEVWPNVD-------NYELYEKL---E--LVKGQ--K-R--KVKDRLKA-Y-VRDPYALDLIDKLLVLDPAQRIDSDDALNHDFF----W--SDPMPSDLKGM---------------------------------------------
115 HHSearch 71.2348%-117 - C1 -4NST CDK12_HUMAN A:[11-308] --------------CVDKFDIIGIIGEGTYGQVYKAKDKD--TGELVALKKVRLDNEKEGFPITAIREIKILRQLIHRSVVNMKEIVTDK--QD------GAFYLVFEYMDHDLMGLL-E------SGL-VHFSE--DHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILL----NNSGQIKLADFGLARLYNSEE---SRP-YTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFT-KK-PIFQANLE----LAQLELISRLCGSPCPAVWPDVI-------KLPYFNTM---K--PKKQY--R-R--RLREEFSF-I---PSAALDLLDHMLTLDPSKRCTAEQTLQSDFL----K--DVELSKMAPPDLPHWQDCHELWSKK-------------------------------
15 PsiBlast_PDB 70.9245%-110 - C1 -4CXA CDK12_HUMAN A:[12-338] ---------------VDKFDIIGIIGEGTYGQVYKAKDKD--TGELVALKKVRLDNEKEGFPITAIREIKILRQLIHRSVVNMKEIVTDKQ--LDFKKDKGAFYLVFEYMDHDLMGLL-E------SGL-VHFSE--DHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILL----NNSGQIKLADFGLARLY----NSEE-RPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFT-KK-PIFQANLE----LAQLELISRLCGSPCPAVWPDVI-------KLPYFNTM---K--PKKQY--R-R--RLREEF-S-F-IPSA-ALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVEL--SKMAPPDL-----PHWQDCHELWSKKRRRQ--------------------------
16 PsiBlast_PDB 69.2645%-111 - C1 -4NST CDK12_HUMAN A:[12-334] ---------------VDKFDIIGIIGEGTYGQVYKAKDKD--TGELVALKKVRLDNEKEGFPITAIREIKILRQLIHRSVVNMKEIVTDKQD--------GAFYLVFEYMDHDLMGLL-E------SGL-VHFSE--DHIKSFMKQLMEGLEYCHKKNFLHRDIKCSNILL----NNSGQIKLADFGLARLY----NSEESRPYTNKVITLWYRPPELLLGEERYTPAIDVWSCGCILGELFT-KK-PIFQANLE----LAQLELISRLCGSPCPAVWPDVI-------KLPYFNTM---K--PKKQY--R-R--RLREEF-S-F-IPSA-ALDLLDHMLTLDPSKRCTAEQTLQSDFLKDVEL--SKMAPPDL-----PHWQDCHELWSKK------------------------------
31 PsiBlast_CBE 67.7940%-118 - C1 -1V0P CDC2H_PLAFK A:[1-284] ---------------MEKYHGLEKIGEGTYGVVYKAQNN---YGETFALKKIRLEKEDEGIPSTTIREISILKELKHSNIVKLYDVIHTK--KR--------LVLVFEHLDQDLKKLL-D------VCE-GGLES--VTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLI----NREGELKIADFGLARAFG--------------IVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVN-GT-PLFPGVSE----ADQLMRIFRILGTPNSKNWPNVTELPKYDPNFTVYEPLPWES--FLKG--------------------LDESGIDLLSKMLKLDPNQRITAKQALEHAYF----K--E-------------------------------------------------------
19 PsiBlast_PDB 65.7340%-119 - C1 -3NIZ ? A:[20-304] ---------------MEKYQKLEKVGEGTYGVVYKAKDSQ---GRIVALKRIR------GIPSTAIREISLLKELHHPNIVSLIDVIHSE-------RC---LTLVFEFMEKDLKKVL-D------ENK-TGLQD--SQIKIYLYQLLRGVAHCHQHRILHRDLKPQNLLI----NSDGALKLADFGLARAFGIPVR--------HEVVTLWYRAPDVLMGSKKYSTSVDIWSIGCIFAEMIT-GK-PLFPGVTD----DDQLPKIFSILGTPNPREWPQVQ-------ELPLWKQR---T--FQVFE--K-K--PWSSIIPG-F-CQE--GIDLLSNMLCFDPNKRISARDAMNHPYF----K--DLDPQI--------------------------------------------------
89 PsiBlast_CBE 65.0439%-111 - C1 -3R83 CDK2_HUMAN A:[12-302] ------------------FQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT----------ENKLYLVFEFLHQDLKKFMDA------SAL-TGIPL--PLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NTEGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-RR-ALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S--FPKWA--R-Q--DFSKVVPP-L-DED--GRSLLSQMLHYDPNKRISAKAALAHPFF----QDVTKPVPHLRL-----------------------------------------------
78 PsiBlast_CBE 64.7339%-112 - C1 -3RAH CDK2_HUMAN A:[12-302] ------------------FQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR--------PSTAIREISLLKELNHPNIVKLLDVIHT----------ENKLYLVFEFLHQDLKKFMDA------SAL-TGIPL--PLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NTEGAIKLADFGLARAFGV-------------VVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-RR-ALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S--FPKWA--R-Q--DFSKVVPP-L-DED--GRSLLSQMLHYDPNKRISAKAALAHPFF----QDVTKPVPHLRL-----------------------------------------------
24 PsiBlast_CBE 64.3541%-115 - C1 -4Y72 ? A:[9-292] ------------------YTKIEKIGEGTYGVVYKGRHKT--TGQVVAMKKIRLESEEEGVPSTAIREISLLKELRHPNIVSLQDVLMQD--S--------RLYLIFEFLSMDLKKYL-D------SIP-PGQYMDSSLVKSYLYQILQGIVFCHSRRVLHRDLKPQNLLI----DDKGTIKLADFGLARAFGI-----PIRVYTHEVVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAELAT-KK-PLFHGDSE----IDQLFRIFRALGTPNNEVWPEVE-------SLQDY-KN---T--FPKWK--P-G--SLASHVKN-L---DENGLDLLSKMLIYDPAKRISGKMALNHPYF----N--D-------------------------------------------------------
96 PsiBlast_CBE 64.3239%-111 - C1 -3R71 CDK2_HUMAN A:[12-302] ------------------FQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT----------ENKLYLVFEFLHQDLKKFMDA------SAL-TGIPL--PLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NTEGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-RR-ALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S--FPKWA--R-Q--DFSKVVPP-L-DED--GRSLLSQMLHYDPNKRISAKAALAHPFF----QDVTKPVPHLRL-----------------------------------------------
93 PsiBlast_CBE 64.3239%-112 - C1 -3R7I CDK2_HUMAN A:[12-302] ------------------FQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR--------PSTAIREISLLKELNHPNIVKLLDVIHT----------ENKLYLVFEFLHQDLKKFMDA------SAL-TGIPL--PLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NTEGAIKLADFGLARAFGV-------------VVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-RR-ALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S--FPKWA--R-Q--DFSKVVPP-L-DED--GRSLLSQMLHYDPNKRISAKAALAHPFF----QDVTKPVPHLRL-----------------------------------------------
83 PsiBlast_CBE 64.2639%-114 - C1 -3R8Z CDK2_HUMAN A:[12-302] ------------------FQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT----------ENKLYLVFEFLHQDLKKFMDA------SAL-TGIPL--PLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NTEGAIKLADFGLARAFGVP---------THEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-RR-ALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S--FPKWA--R-Q--DFSKVVPP-L-DED--GRSLLSQMLHYDPNKRISAKAALAHPFF----QDVTKPVPHLRL-----------------------------------------------
64 PsiBlast_CBE 64.2239%-111 - C1 -3RPO CDK2_HUMAN A:[12-302] ------------------FQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT----------ENKLYLVFEFLHQDLKKFMDA------SAL-TGIPL--PLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NTEGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-RR-ALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S--FPKWA--R-Q--DFSKVVPP-L-DED--GRSLLSQMLHYDPNKRISAKAALAHPFF----QDVTKPVPHLRL-----------------------------------------------
86 PsiBlast_CBE 64.1139%-112 - C1 -3R8P CDK2_HUMAN A:[12-302] ------------------FQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT----------ENKLYLVFEFLHQDLKKFMDA------SAL-TGIPL--PLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NTEGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-RR-ALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S--FPKWA--R-Q--DFSKVVPP-L-DED--GRSLLSQMLHYDPNKRISAKAALAHPFF----QDVTKPVPHLRL-----------------------------------------------
80 PsiBlast_CBE 64.0339%-111 - C1 -3R9N CDK2_HUMAN A:[12-302] ------------------FQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR--------PSTAIREISLLKELNHPNIVKLLDVIHT----------ENKLYLVFEFLHQDLKKFMDA------SAL-TGIPL--PLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NTEGAIKLADFGLARAFGV-------------VVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-RR-ALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S--FPKWA--R-Q--DFSKVVPP-L-DED--GRSLLSQMLHYDPNKRISAKAALAHPFF----QDVTKPVPHLRL-----------------------------------------------
133 HHSearch 63.9941%-109 - C1 -4AU8 CDK5_HUMAN A:[5-292] ---------------SQKYEKLEKIGEGTYGTVFKAKNRE--THEIVALKRV---------PSSALREICLLKELKHKNIVRLHDVLH-------------KLTLVFEFCDQDLKKYF-D------SCN-GDLDP--EIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLI----NRNGELKLADFGLARAFGIPV----R---SAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGR-PLFPGNDV----DDQLKRIFRLLGTPTEEQWPSMT-------KLPDYKPY---P--MYPAT--T-S---LVNVVPK-L---NATGRDLLQNLLKCNPVQRISAEEALQHPYF----S--DF------------------------------------------------------
63 PsiBlast_CBE 63.7539%-112 - C1 -3RPR CDK2_HUMAN A:[12-302] ------------------FQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR--------PSTAIREISLLKELNHPNIVKLLDVIHT----------ENKLYLVFEFLHQDLKKFMDA------SAL-TGIPL--PLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NTEGAIKLADFGLARAFGV-------------VVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-RR-ALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S--FPKWA--R-Q--DFSKVVPP-L-DED--GRSLLSQMLHYDPNKRISAKAALAHPFF----QDVTKPVPHLRL-----------------------------------------------
28 PsiBlast_CBE 63.7540%-118 - C1 -1V0O CDC2H_PLAFK B:[3-284] -----------------KYHGLEKIGEGTYGVVYKAQNN---YGETFALKKIRL----------TIREISILKELKHSNIVKLYDVIHTK--KR--------LVLVFEHLDQDLKKLL-D------VCE-GGLES--VTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLI----NREGELKIADFGLARAFGIP----VRK-YTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVN-GT-PLFPGVSE----ADQLMRIFRILGTPNSKNWPNVTELPKYDPNFTVYEPLPWES--FLKG--------------------LDESGIDLLSKMLKLDPNQRITAKQALEHAYF----K--EN------------------------------------------------------
59 PsiBlast_CBE 63.6839%-110 - C1 -3S00 CDK2_HUMAN A:[12-302] ------------------FQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT----------ENKLYLVFEFLHQDLKKFMDA------SAL-TGIPL--PLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NTEGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-RR-ALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S--FPKWA--R-Q--DFSKVVPP-L-DED--GRSLLSQMLHYDPNKRISAKAALAHPFF----QDVTKPVPHLRL-----------------------------------------------
92 PsiBlast_CBE 63.6539%-111 - C1 -3R7U CDK2_HUMAN A:[12-302] ------------------FQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR--------PSTAIREISLLKELNHPNIVKLLDVIHT----------ENKLYLVFEFLHQDLKKFMDA------SAL-TGIPL--PLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NTEGAIKLADFGLARAFGV-------------VVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-RR-ALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S--FPKWA--R-Q--DFSKVVPP-L-DED--GRSLLSQMLHYDPNKRISAKAALAHPFF----QDVTKPVPHLRL-----------------------------------------------
116 HHSearch 63.5941% -99 - C1 -1UA2 CDK7_HUMAN A:[13-304] -------------------EKLDFLGEGQFATVYKARDKN--TNQIVAIKKI---------NRTALREIKLLQELSHPNIIGLLDAFGHK----------SNISLVFDFMETDLEVII-K------DNS-LVLTP--SHIKAYMLMTLQGLEYLHQHWILHRDLKPNNLLL----DENGVLKLADFGLAKSFGSP----NRA-YTHQVVTRWYRAPELLFGARMYGVGVDMWAVGCILAELLL-RV-PFLPGDSD----LDQLTRIFETLGTPTEEQWPDMC-------SLPDYVTF---K--S--FP--G-I--PLHHIFSA-A---GDDLLDLIQGLFLFNPCARITATQALKMKYF----S--NRPGPTPGCQLPRPN-----------------------------------------
25 PsiBlast_CBE 63.5241%-112 - C1 -4AU8 CDK5_HUMAN B:[7-293] -----------------KYEKLEKIGEGTYGTVFKAKNRE--THEIVALKRVRL----EGVPSSALREICLLKELKHKNIVRLHDVLHS---K--------KLTLVFEFCDQDLKKYF-D------SCN-GDLDP--EIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLI----NRNGELKLADFGLARAFGI-----PV------VVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELAN-AGRPLFPGNDV----DDQLKRIFRLLGTPTEEQWPSMT-------KLPDYKPY---P--MYPAT--T-SLVNVVPKLNA-T-GR-----DLLQNLLKCNPVQRISAEEALQHPYF-------SDF-----------------------------------------------------
90 PsiBlast_CBE 63.5039%-112 - C1 -3R7Y CDK2_HUMAN A:[12-302] ------------------FQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT----------ENKLYLVFEFLHQDLKKFMDA------SAL-TGIPL--PLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NTEGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-RR-ALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S--FPKWA--R-Q--DFSKVVPP-L-DED--GRSLLSQMLHYDPNKRISAKAALAHPFF----QDVTKPVPHLRL-----------------------------------------------
77 PsiBlast_CBE 63.3839%-110 - C1 -3RAI CDK2_HUMAN A:[12-302] ------------------FQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT----------ENKLYLVFEFLHQDLKKFMDA------SAL-TGIPL--PLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NTEGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-RR-ALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S--FPKWA--R-Q--DFSKVVPP-L-DED--GRSLLSQMLHYDPNKRISAKAALAHPFF----QDVTKPVPHLRL-----------------------------------------------
29 PsiBlast_CBE 63.3740%-115 - C1 -1V0O CDC2H_PLAFK A:[3-284] -----------------KYHGLEKIGEGTYGVVYKAQNN---YGETFALKKIRL--------STTIREISILKELKHSNIVKLYDVIHTK--KR--------LVLVFEHLDQDLKKLL-D------VCE-GGLES--VTAKSFLLQLLNGIAYCHDRRVLHRDLKPQNLLI----NREGELKIADFGLARAFGIP----VRK-YTHEVVTLWYRAPDVLMGSKKYSTTIDIWSVGCIFAEMVN-GT-PLFPGVSE----ADQLMRIFRILGTPNSKNWPNVTELPKYDPNFTVYEPLPWES--FLKG--------------------LDESGIDLLSKMLKLDPNQRITAKQALEHAYF----K--EN------------------------------------------------------
101 PsiBlast_CBE 63.2439%-109 - C1 -3R1Q CDK2_HUMAN A:[12-302] ------------------FQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT----------ENKLYLVFEFLHQDLKKFMDA------SAL-TGIPL--PLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NTEGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-RR-ALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S--FPKWA--R-Q--DFSKVVPP-L-DED--GRSLLSQMLHYDPNKRISAKAALAHPFF----QDVTKPVPHLRL-----------------------------------------------
94 PsiBlast_CBE 63.2439%-112 - C1 -3R7E CDK2_HUMAN A:[12-302] ------------------FQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT----------ENKLYLVFEFLHQDLKKFMDA------SAL-TGIPL--PLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NTEGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-RR-ALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S--FPKWA--R-Q--DFSKVVPP-L-DED--GRSLLSQMLHYDPNKRISAKAALAHPFF----QDVTKPVPHLRL-----------------------------------------------
103 PsiBlast_CBE 63.1939%-109 - C1 -3QZH CDK2_HUMAN A:[12-302] ------------------FQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT----------ENKLYLVFEFLHQDLKKFMDA------SAL-TGIPL--PLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NTEGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-RR-ALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S--FPKWA--R-Q--DFSKVVPP-L-DED--GRSLLSQMLHYDPNKRISAKAALAHPFF----QDVTKPVPHLRL-----------------------------------------------
58 PsiBlast_CBE 63.1539%-112 - C1 -3S0O CDK2_HUMAN A:[12-302] ------------------FQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIRL---TEGVPSTAIREISLLKELNHPNIVKLLDVIHT----------ENKLYLVFEFLHQDLKKFMDA------SAL-TGIPL--PLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NTEGAIKLADF--ARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-RR-ALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S--FPKWA--R-Q--DFSKVVPP-L-DED--GRSLLSQMLHYDPNKRISAKAALAHPFF----QDVTKPVPHLRL-----------------------------------------------
49 PsiBlast_CBE 63.1140%-112 - C1 -1UNL CDK5_HUMAN A:[1-291] ---------------MQKYEKLEKIGEGTYGTVFKAKNRE--THEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSD--K--------KLTLVFEFCDQDLKKYF-D------SCN-GDLDP--EIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLI----NRNGELKLANFGLARAFGI-----PVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELAN-AGRPLFPGNDV----DDQLKRIFRLLGTPTEEQWPSMT-------KLPDYKPY---P--MYPAT--T-SLVNVVPKLNA-T-GR-----DLLQNLLKCNPVQRISAEEALQHPYF-------SDFCPP--------------------------------------------------
102 PsiBlast_CBE 62.9939%-110 - C1 -3QZI CDK2_HUMAN A:[12-302] ------------------FQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT----------ENKLYLVFEFLHQDLKKFMDA------SAL-TGIPL--PLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NTEGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-RR-ALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S--FPKWA--R-Q--DFSKVVPP-L-DED--GRSLLSQMLHYDPNKRISAKAALAHPFF----QDVTKPVPHLRL-----------------------------------------------
99 PsiBlast_CBE 62.8539%-110 - C1 -3R1Y CDK2_HUMAN A:[12-302] ------------------FQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT----------ENKLYLVFEFLHQDLKKFMDA------SAL-TGIPL--PLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NTEGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-RR-ALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S--FPKWA--R-Q--DFSKVVPP-L-DED--GRSLLSQMLHYDPNKRISAKAALAHPFF----QDVTKPVPHLRL-----------------------------------------------
52 PsiBlast_CBE 62.8340%-117 - C1 -1UNG CDK5_HUMAN A:[1-291] ---------------MQKYEKLEKI----YGTVFKAKNRE--THEIVALKRVRLDDDDEGVPSSALREICLLKELKHKNIVRLHDVLHSD--K--------KLTLVFEFCDQDLKKYF-D------SCN-GDLDP--EIVKSFLFQLLKGLGFCHSRNVLHRDLKPQNLLI----NRNGELKLANFGLARAFGI-----PVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELAN-AGRPLFPGNDV----DDQLKRIFRLLGTPTEEQWPSMT-------KLPDYKPY---P--MYPAT--T-SLVNVVPKLNA-T-GR-----DLLQNLLKCNPVQRISAEEALQHPYF-------SDFCPP--------------------------------------------------
100 PsiBlast_CBE 62.8039%-109 - C1 -3R1S CDK2_HUMAN A:[12-302] ------------------FQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT----------ENKLYLVFEFLHQDLKKFMDA------SAL-TGIPL--PLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NTEGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-RR-ALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S--FPKWA--R-Q--DFSKVVPP-L-DED--GRSLLSQMLHYDPNKRISAKAALAHPFF----QDVTKPVPHLRL-----------------------------------------------
85 PsiBlast_CBE 62.7839%-108 - C1 -3R8U CDK2_HUMAN A:[12-302] ------------------FQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT----------ENKLYLVFEFLHQDLKKFMDA------SAL-TGIPL--PLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NTEGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-RR-ALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S--FPKWA--R-Q--DFSKVVPP-L-DED--GRSLLSQMLHYDPNKRISAKAALAHPFF----QDVTKPVPHLRL-----------------------------------------------
84 PsiBlast_CBE 62.7839%-111 - C1 -3R8V CDK2_HUMAN A:[12-302] ------------------FQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT----------ENKLYLVFEFLHQDLKKFMDA------SAL-TGIPL--PLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NTEGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-RR-ALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S--FPKWA--R-Q--DFSKVVPP-L-DED--GRSLLSQMLHYDPNKRISAKAALAHPFF----QDVTKPVPHLRL-----------------------------------------------
68 PsiBlast_CBE 62.7539%-113 - C1 -3RM7 CDK2_HUMAN A:[12-302] ------------------FQKVEKIGEGTYGVVYKARNKL--TGEVVALKKIR----TEGVPSTAIREISLLKELNHPNIVKLLDVIHT----------ENKLYLVFEFLHQDLKKFMDA------SAL-TGIPL--PLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLI----NTEGAIKLADFGLARAFGVPVRT-----YTHEVVTLWYRAPEILLGCKYYSTAVDIWSLGCIFAEMVT-RR-ALFPGDSE----IDQLFRIFRTLGTPDEVVWPGVT-------SMPDY-KP---S--FPKWA--R-Q--DFSKVVPP-L-DED--GRSLLSQMLHYDPNKRISAKAALAHPFF----QDVTKPVPHLRL-----------------------------------------------