@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : CSK22_HUMAN: (2015-10-05 )
MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQDDYQLVRKLGRGKYSEVFEAINITNNERVVVKILKPVKKKKIKREVKILENLRGGTNIIKLIDTVKDPVSKTPALVFEYINNTDFKQLYQILTDFDIRFYMYELLKALDYCHSKGIMHRDVKPHNVMIDHQQKKLRLIDWGLAEFYHPAQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCMLASMIFRREPFFHGQDNYDQLVRIAKVLGTEELYGYLKKYHIDLDPHFNDILGQHSRKRWENFIHSENRHLVSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR

Atome Classification :

(94 SA) -----.........10........20........30......-..40........50........60.........70.---.-----.------.----....80........90-------------------------------------.........100....---.----..110--.........120.....----..130.......140.......150........160.......170---........180..-...-----.-.190.......200...---....210.......220......-.230.......240.......250..---.....260.......270..---..--...280....--..----.290.-......300.......310.......320.......330.......340.......350
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) -----MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQ-DDYQLVRKLGRGKYSEVFEAINI-TNNERVVVKILK---P-----V------K----KKKIKREVKILENLR--------------------------------------GGTNIIKLIDTVKDPV---S----KTP----ALVFEYINNTDFKQLYQ----ILTDFDIRFYMYELLKALDYCHSK-GIMHRDVKPHNVMIDHQQKK----LRLIDWGLAEFYH-PAQ-----E-YNVRVASRYFKGPELLV---DYQMYDYSLDMWSLGCMLASMIF-RREPFFHGQDNYDQLVRIAKVLGTEE---LYGYLKKYHIDLDPHFNDIL---GQ--HSRKRWENFI--HS----ENRHL-VSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQPCADNAVLSSGLTAAR-
1 PsiBlast_PDB 91.9699%-120 - C1 -3OFM CSK22_HUMAN A:[8-332] ------------SRARVYAEVNSLRSREYWDYEAHVPSWGNQ-DDYQLVRKLGRGKYSEVFEAINI-TNNERVVVKILK---P-----V------K----KKKIKREVKILENLR--------------------------------------GGTNIIKLIDTVKDPV---S----KTP----ALVFEYINNTDFKQLYQ----ILTDFDIRFYMYELLKALDYCHSK-GIMHRDVKPHNVMIDHQQKK----LRLIDWGLAEFYH-PAQ-----E-YNVRVASRYFKGPELLV---DYQMYDYSLDMWSLGCMLASMIF-RREPFFHGQDNYDQLVRIAKVLGTEE---LYGYLKKYHIDLDPHFNDIL---GQ--HSRKRWENFI--HS----ENRHL-VSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQ-------------------
2 PsiBlast_PDB 90.92100%-117 - C1 -3E3B CSK22_HUMAN X:[6-339] -----MPGPAAGSRARVYAEVNSLRSREYWDYEAHVPSWGNQ-DDYQLVRKLGRGKYSEVFEAINI-TNNERVVVKILK---P-----V------K----KKKIKREVKILENLR--------------------------------------GGTNIIKLIDTVKDPV---S----KTP----ALVFEYINNTDFKQLYQ----ILTDFDIRFYMYELLKALDYCHSK-GIMHRDVKPHNVMIDHQQKK----LRLIDWGLAEFYH-PAQ-----E-YNVRVASRYFKGPELLV---DYQMYDYSLDMWSLGCMLASMIF-RREPFFHGQDNYDQLVRIAKVLGTEE---LYGYLKKYHIDLDPHFNDIL---GQ--HSRKRWENFI--HS----ENRHL-VSPEALDLLDKLLRYDHQQRLTAKEAMEHPYFYPVVKEQSQ-----------------
46 PsiBlast_CBE 90.4585%-117 - C1 -4IB5 CSK21_HUMAN C:[2-333] ------SGPVP-SRARVYTDVNTHRPREYWDYESHVVEWGNQ-DDYQLVRKLGRGKYSEVFEAINI-TNNEKVVVKILK---P-----V------K----KKKIKREIKILENLR--------------------------------------GGPNIITLADIVKDPV---S----RTP----ALVFEHVNNTDFKQLYQ----TLTDYDIRFYMYEILKALDYCHSM-GIMHRDVKPHNVMIDHEHRK----LRLIDWGLAEFYH-PGQ-----E-YNVRVASRYFKGPELLV---DYQMYDYSLDMWSLGCMLASMIF-RKEPFFHGHDNYDQLVRIAKVLGTED---LYDYIDKYNIELDPRFNDIL---GR--HSRKRWERFV--HS----ENQHL-VSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQAR-----------------
70 PsiBlast_CBE 90.1685%-115 - C1 -3OWL CSK21_HUMAN A:[2-331] ------SGPVP-SRARVYTDVNTHRPREYWDYESHVVEWGNQ-DDYQLVRKLGRGKYSEVFEAINI-TNNEKVVVKILK---P-----V------K----KKKIKREIKILENLR--------------------------------------GGPNIITLADIVKDPV---S----RTP----ALVFEHVNNTDFKQLYQ----TLTDYDIRFYMYEILKALDYCHSM-GIMHRDVKPHNVMIDHEHRK----LRLIDWGLAEFYH-PGQ-----E-YNVRVASRYFKGPELLV---DYQMYDYSLDMWSLGCMLASMIF-RKEPFFHGHDNYDQLVRIAKVLGTED---LYDYIDKYNIELDPRFNDIL---GR--HSRKRWERFV--HS----ENQHL-VSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQ-------------------
42 PsiBlast_CBE 90.1685%-118 - C1 -4UB7 CSK21_HUMAN A:[2-333] ------SGPVP-SRARVYTDVNTHRPREYWDYESHVVEWGNQ-DDYQLVRKLGRGKYSEVFEAINI-TNNEKVVVKILK---P-----V------K----KKKIKREIKILENLR--------------------------------------GGPNIITLADIVKDPV---S----RTP----ALVFEHVNNTDFKQLYQ----TLTDYDIRFYMYEILKALDYCHSM-GIMHRDVKPHNVMIDHEHRK----LRLIDWGLAEFYH-PGQ-----E-YNVRVASRYFKGPELLV---DYQMYDYSLDMWSLGCMLASMIF-RKEPFFHGHDNYDQLVRIAKVLGTED---LYDYIDKYNIELDPRFNDIL---GR--HSRKRWERFV--HS----ENQHL-VSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMG---------------
15 PsiBlast_PDB 89.9985%-114 - C1 -3WAR CSK21_HUMAN A:[7-338] ------SGPVP-SRARVYTDVNTHRPREYWDYESHVVEWGNQ-DDYQLVRKLGRGKYSEVFEAINI-TNNEKVVVKILK---P-----V------K----KKKIKREIKILENLR--------------------------------------GGPNIITLADIVKDPV---S----RTP----ALVFEHVNNTDFKQLYQ----TLTDYDIRFYMYEILKALDYCHSM-GIMHRDVKPHNVMIDHEHRK----LRLIDWGLAEFYH-PGQ-----E-YNVRVASRYFKGPELLV---DYQMYDYSLDMWSLGCMLASMIF-RKEPFFHGHDNYDQLVRIAKVLGTED---LYDYIDKYNIELDPRFNDIL---GR--HSRKRWERFV--HS----ENQHL-VSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMG---------------
71 PsiBlast_CBE 89.9085%-116 - C1 -3OWK CSK21_HUMAN A:[2-331] ------SGPVP-SRARVYTDVNTHRPREYWDYESHVVEWGNQ-DDYQLVRKLGRGKYSEVFEAINI-TNNEKVVVKILK---P-----V------K----KKKIKREIKILENLR--------------------------------------GGPNIITLADIVKDPV---S----RTP----ALVFEHVNNTDFKQLYQ----TLTDYDIRFYMYEILKALDYCHSM-GIMHRDVKPHNVMIDHEHRK----LRLIDWGLAEFYH-PGQ-----E-YNVRVASRYFKGPELLV---DYQMYDYSLDMWSLGCMLASMIF-RKEPFFHGHDNYDQLVRIAKVLGTED---LYDYIDKYNIELDPRFNDIL---GR--HSRKRWERFV--HS----ENQHL-VSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQ-------------------
34 PsiBlast_CBE 89.8485%-116 - C1 -3Q9X CSK21_HUMAN B:[2-331] ------SGPVP-SRARVYTDVNTHRPREYWDYESHVVEWGNQ-DDYQLVRKLGRGKYSEVFEAINI-TNNEKVVVKILK---P-----V------K----KKKIKREIKILENLR--------------------------------------GGPNIITLADIVKDPV---S----RTP----ALVFEHVNNTDFKQLYQ----TLTDYDIRFYMYEILKALDYCHSM-GIMHRDVKPHNVMIDHEHRK----LRLIDWGLAEFYH-PGQ-----E-YNVRVASRYFKGPELLV---DYQMYDYSLDMWSLGCMLASMIF-RKEPFFHGHDNYDQLVRIAKVLGTED---LYDYIDKYNIELDPRFNDIL---GR--HSRKRWERFV--HS----ENQHL-VSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQ-------------------
50 PsiBlast_CBE 89.8085%-120 - C1 -4BXB CSK21_HUMAN A:[2-329] ------SGPVP-SRARVYTDVNTHRPREYWDYESHVVEWGNQ-DDYQLVRKLGRGKYSEVFEAINI-TNNEKVVVKILK---P-----V------K----KKKIKREIKILENLR--------------------------------------GGPNIITLADIVKDPV---S----RTP----ALVFEHVNNTDFKQLYQ----TLTDYDIRFYMYEILKALDYCHSM-GIMHRDVKPHNVMIDHEHRK----LRLIDWGLAEFYH-PGQ-----E-YNVRVASRYFKGPELLV---DYQMYDYSLDMWSLGCMLASMIF-RKEPFFHGHDNYDQLVRIAKVLGTED---LYDYIDKYNIELDPRFNDIL---GR--HSRKRWERFV--HS----ENQHL-VSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVK---------------------
13 PsiBlast_PDB 89.7685%-116 - C1 -3AT4 CSK21_HUMAN A:[7-337] ------SGPVP-SRARVYTDVNTHRPREYWDYESHVVEWGNQ-DDYQLVRKLGRGKYSEVFEAINI-TNNEKVVVKILK---P-----V------K----KKKIKREIKILENLR--------------------------------------GGPNIITLADIVKDPV---S----RTP----ALVFEHVNNTDFKQLYQ----TLTDYDIRFYMYEILKALDYCHSM-GIMHRDVKPHNVMIDHEHRK----LRLIDWGLAEFYH-PGQ-----E-YNVRVASRYFKGPELLV---DYQMYDYSLDMWSLGCMLASMIF-RKEPFFHGHDNYDQLVRIAKVLGTED---LYDYIDKYNIELDPRFNDIL---GR--HSRKRWERFV--HS----ENQHL-VSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQA------------------
53 PsiBlast_CBE 89.6985%-116 - C1 -3U9C CSK21_HUMAN B:[2-332] ------SGPVP-SRARVYTDVNTHRPREYWDYESHVVEWGNQ-DDYQLVRKLGRGKYSEVFEAINI-TNNEKVVVKILK---P-----V------K----KKKIKREIKILENLR--------------------------------------GGPNIITLADIVKDPV---S----RTP----ALVFEHVNNTDFKQLYQ----TLTDYDIRFYMYEILKALDYCHSM-GIMHRDVKPHNVMIDHEHRK----LRLIDWGLAEFYH-PGQ-----E-YNVRVASRYFKGPELLV---DYQMYDYSLDMWSLGCMLASMIF-RKEPFFHGHDNYDQLVRIAKVLGTED---LYDYIDKYNIELDPRFNDIL---GR--HSRKRWERFV--HS----ENQHL-VSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQA------------------
120 HHSearch 89.6585%-113 * C1 *3WAR CSK21_HUMAN A:[7-339] ------SGP-VPSRARVYTDVNTHRPREYWDYESHVVEWGNQ-DDYQLVRKLGRGKYSEVFEAINI-TNNEKVVVKILK---P-----V------K----KKKIKREIKILENLR--------------------------------------GGPNIITLADIVKDPV---S----RTP----ALVFEHVNNTDFKQLYQ----TLTDYDIRFYMYEILKALDYCHSM-GIMHRDVKPHNVMIDHEHRK----LRLIDWGLAEFYH-PGQ-----E-YNVRVASRYFKGPELLV---DYQMYDYSLDMWSLGCMLASMIF-RKEPFFHGHDNYDQLVRIAKVLGTED---LYDYIDKYNIELDPRFNDIL---GR--HSRKRWERFV--HS----ENQHL-VSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMG---------------
11 PsiBlast_PDB 89.6585%-114 - C1 -3AT2 CSK21_HUMAN A:[7-338] ------SGPVP-SRARVYTDVNTHRPREYWDYESHVVEWGNQ-DDYQLVRKLGRGKYSEVFEAINI-TNNEKVVVKILK---P-----V------K----KKKIKREIKILENLR--------------------------------------GGPNIITLADIVKDPV---S----RTP----ALVFEHVNNTDFKQLYQ----TLTDYDIRFYMYEILKALDYCHSM-GIMHRDVKPHNVMIDHEHRK----LRLIDWGLAEFYH-PGQ-----E-YNVRVASRYFKGPELLV---DYQMYDYSLDMWSLGCMLASMIF-RKEPFFHGHDNYDQLVRIAKVLGTED---LYDYIDKYNIELDPRFNDIL---GR--HSRKRWERFV--HS----ENQHL-VSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMG---------------
47 PsiBlast_CBE 89.5085%-119 - C1 -4IB5 CSK21_HUMAN B:[3-331] -------GPVP-SRARVYTDVNTHRPREYWDYESHVVEWGNQ-DDYQLVRKLGRGKYSEVFEAINI-TNNEKVVVKILK---P-----V------K----KKKIKREIKILENLR--------------------------------------GGPNIITLADIVKDPV---S----RTP----ALVFEHVNNTDFKQLYQ----TLTDYDIRFYMYEILKALDYCHSM-GIMHRDVKPHNVMIDHEHRK----LRLIDWGLAEFYH-PGQ-----E-YNVRVASRYFKGPELLV---DYQMYDYSLDMWSLGCMLASMIF-RKEPFFHGHDNYDQLVRIAKVLGTED---LYDYIDKYNIELDPRFNDIL---GR--HSRKRWERFV--HS----ENQHL-VSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQ-------------------
30 PsiBlast_CBE 89.4285%-115 - C1 -3QA0 CSK21_HUMAN A:[2-331] ------SGPVP-SRARVYTDVNTHRPREYWDYESHVVEWGNQ-DDYQLVRKLGRGKYSEVFEAINI-TNNEKVVVKILK---P-----V------K----KKKIKREIKILENLR--------------------------------------GGPNIITLADIVKDPV---S----RTP----ALVFEHVNNTDFKQLYQ----TLTDYDIRFYMYEILKALDYCHSM-GIMHRDVKPHNVMIDHEHRK----LRLIDWGLAEFYH-PGQ-----E-YNVRVASRYFKGPELLV---DYQMYDYSLDMWSLGCMLASMIF-RKEPFFHGHDNYDQLVRIAKVLGTED---LYDYIDKYNIELDPRFNDIL---GR--HSRKRWERFV--HS----ENQHL-VSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQ-------------------
3 PsiBlast_PDB 89.3587%-118 - C1 -3U87 CSK21_HUMAN (first) A:[2-330] ------SGPVP-SRARVYTDVNTHRPREYWDYESHVVEWGNQ-DDYQLVRKLGRGKYSEVFEAINI-TNNEKVVVKILK---P-----V------K----KKKIKREIKILENLR--------------------------------------GGPNIITLADIVKDPV---S----RTP----ALVFEHVNNTDFKQLYQ----TLTDYDIRFYMYEILKALDYCHSM-GIMHRDVKPHNVMIDHEHRK----LRLIDWGLAEFYH-PGQ-----E-YNVRVASRYFKGPELLV---DYQMYDYSLDMWSLGCMLASMIF-RKEPFFHGHDNYDQLVRIAKVLGTED---LYDYIDKYNIELDPRFNDIL---GR--HSRKRWERFV--HS----ENQHL-VSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYPVVKE--------------------
62 PsiBlast_CBE 89.1985%-111 - C1 -3H30 CSK21_HUMAN A:[2-333] ------SGPVP-SRARVYTDVNTHRPREYWDYESHVVEWGNQ-DDYQLVRKLGRGKYSEVFEAINI-TNNEKVVVKILK---P-----V------K----KKKIKREIKILENLR--------------------------------------GGPNIITLADIVKDPV---S----RTP----ALVFEHVNNTDFKQLYQ----TLTDYDIRFYMYEILKALDYCHSM-GIMHRDVKPHNVMIDHEHRK----LRLIDWGLAEFYH-PGQ-----E-YNVRVASRYFKGPELLV---DYQMYDYSLDMWSLGCMLASMIF-RKEPFFHGHDNYDQLVRIAKVLGTED---LYDYIDKYNIELDPRFNDIL---GR--HSRKRWERFV--HS----ENQHL-VSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARM----------------
40 PsiBlast_CBE 89.1485%-115 - C1 -4UBA CSK21_HUMAN B:[2-333] ------SGPVP-SRARVYTDVNTHRPREYWDYESHVVEWGNQ-DDYQLVRKLGRGKYSEVFEAINI-TNNEKVVVKILK---P-----V------K----KKKIKREIKILENLR--------------------------------------GGPNIITLADIVKDPV---S----RTP----ALVFEHVNNTDFKQLYQ----TLTDYDIRFYMYEILKALDYCHSM-GIMHRDVKPHNVMIDHEHRK----LRLIDWGLAEFYH-PGQ-----E-YNVRVASRYFKGPELLV---DYQMYDYSLDMWSLGCMLASMIF-RKEPFFHGHDNYDQLVRIAKVLGTED---LYDYIDKYNIELDPRFNDIL---GR--HSRKRWERFV--HS----ENQHL-VSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARM----------------
52 PsiBlast_CBE 89.1285%-115 - C1 -4BXA CSK21_HUMAN A:[2-332] ------SGPVP-SRARVYTDVNTHRPREYWDYESHVVEWGNQ-DDYQLVRKLGRGKYSEVFEAINI-TNNEKVVVKILK---P-----V------K----KKKIKREIKILENLR--------------------------------------GGPNIITLADIVKDPV---S----RTP----ALVFEHVNNTDFKQLYQ----TLTDYDIRFYMYEILKALDYCHSM-GIMHRDVKPHNVMIDHEHRK----LRLIDWGLAEFYH-PGQ-----E-YNVRVASRYFKGPELLV---DYQMYDYSLDMWSLGCMLASMIF-RKEPFFHGHDNYDQLVRIAKVLGTED---LYDYIDKYNIELDPRFNDIL---GR--HSRKRWERFV--HS----ENQHL-VSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQA------------------
21 PsiBlast_CBE 89.1087%-117 - C1 -3U87 CSK21_HUMAN (first) B:[2-330] ------SGPVP-SRARVYTDVNTHRPREYWDYESHVVEWGNQ-DDYQLVRKLGRGKYSEVFEAINI-TNNEKVVVKILK---P-----V------K----KKKIKREIKILENLR--------------------------------------GGPNIITLADIVKDPV---S----RTP----ALVFEHVNNTDFKQLYQ----TLTDYDIRFYMYEILKALDYCHSM-GIMHRDVKPHNVMIDHEHRK----LRLIDWGLAEFYH-PGQ-----E-YNVRVASRYFKGPELLV---DYQMYDYSLDMWSLGCMLASMIF-RKEPFFHGHDNYDQLVRIAKVLGTED---LYDYIDKYNIELDPRFNDIL---GR--HSRKRWERFV--HS----ENQHL-VSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYPVVKE--------------------