@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : new_query: (2014-05-01 )
TIQCGTVTSTLAQCLTYLTNSGPLPSQCCVGVKSLYQLAQTTPDRKQVCECLKLAGKEIKGLNTDLVAALPTTCGVSIPYPISFSTNCDSISTAV

Atome Classification :

(20 SA) --------------------------------------------------------------------------------------------------------------------------------------------------.........--10-........------------------.20---.----.----.--------------.------------.----...---.30........40----------.........50..---..-...-.-------60------.---------.-------.----------......70-........-----.80........90....------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) --------------------------------------------------------------------------------------------------------------------------------------------------TIQCGTVTS--T--LAQCLTYL------------------TN----S----G----P--------------L------------P----SQC---CVGVKSLYQLAQ-----------TTPDRKQVCECLK---LA-GKE-I-------K-------G---------L-------N----------TDLVAAL--PTTCGVSI-----PYPISFSTNCDSISTAV------
15 HHSearch 93.8748%-142 - C2 -1SIY - NLTP1_VIGRR A:[1-91] ---------------------------------------------------------------------------------------------------------------------------------------------------MTCGQVQG--N--LAQCIGFL------------------QK----G----G----V--------------V------------P----PSC---CTGVKNILNSSR-----------TTADRRAVCSCLK---AA-AGA-V-------R-------G---------I-------N----------PNNAEAL--PGKCGVNI-----PYKISTSTNCNSIN---------
11 HHSearch 91.5648%-147 - C2 -2ALG NLTP1_PRUPE A:[1-92] --------------------------------------------------------------------------------------------------------------------------------------------------MITCGQVSS--S--LAPCIPYV------------------RG----G----G----A--------------V------------P----PAC---CNGIRNVNNLAR-----------TTPDRQAACNCLK---QL-SAS-V-------P-------G---------V-------N----------PNNAAAL--PGKCGVSI-----PYKISASTNCATVK---------
14 HHSearch 90.9653%-150 - C2 -1T12 - NLTP1_TOBAC A:[1-91] --------------------------------------------------------------------------------------------------------------------------------------------------AITCGQVTS--N--LAPCLAYL------------------RN----T----G-------------------P------------L----GRC---CGGVKALVNSAR-----------TTEDRQIACTCLK---SA-AGA-I-------S-------G---------I-------N----------LGKAAGL--PSTCGVNI-----PYKISPSTDCSKVQ---------
12 HHSearch 90.9046%-139 - C2 -1AFH - NLTP_MAIZE A:[1-93] --------------------------------------------------------------------------------------------------------------------------------------------------AISCGQVAS--A--IAPCISYA------------------RG----Q----G----SG-------------P------------S----AGC---CSGVRSLNNAAR-----------TTADRRAACNCLK---NA-AAG-V-------S-------G---------L-------N----------AGNAASI--PSKCGVSI-----PYTISTSTDCSRVN---------
31 SP3 90.5744%-141 - C2 -1FK5 NLTP_MAIZE A:[1-93] --------------------------------------------------------------------------------------------------------------------------------------------------AISCGQVAS--A--IAPCISYA------------------RG----Q----G----SG-------------P------------S----AGC---CSGVRSLNNAAR-----------TTADRRAACNCLK---NA-AAG-V-------S-------G---------L-------N----------AGNAASI--PSKCGVSI-----PYTISTSTDCSRVN---------
16 HHSearch 85.8239%-150 - C2 -1BWO NLTP1_WHEAT A:[1-90] ---------------------------------------------------------------------------------------------------------------------------------------------------IDCGHVDS--L--VRPCLSYV------------------QG----G----P----G--------------P------------S----GQC---CDGVKNLHNQAR-----------SQSDRQSACNCLK---GI-ARG-I-------H-------N---------L-------N----------EDNARSI--PPKCGVNL-----PYTISLNIDCSRV----------
28 HHSearch 61.2329%-137 - C2 -1SM7 - ? A:[13-101] ----------------------------------------------------------------------------------------------------------------------------------------------------------Q--H--LRACQQWI------------------RQ----QLAG-S----PFSENQWGPQQGPS-L------------R----EQC---CNELYQE-------------------DQVCVCPTLK---QA-AKS-V-------RVQ-----GQ--------H-------GPFQSTRI---YQIAKNL--PNVCNMKQ-----I----------------------
23 HHSearch 58.0723%-156 - C2 -1BEA - ITRF_MAIZE A:[15-110] ----------------------------------------------------------------------------------------------------------------------------------------------------------N--P--LPSCRWYV------------------TSRTCGI----G----PR-------------LPWPEL-------K----RRC---CRELADI-------------------PAYCRCTALS---IL-MDG-A-------IPPGPDAQLEGR------L-------EDLPGCPREVQRGFAATLVTEAECNLAT-----IS---------------------
22 HHSearch 56.1525%-113 - C2 -2LVF - ? A:[16-101] ----------------------------------------------------------------------------------------------------------------------------------------------------------Q--M--LSHCRMYM------------------RQQME-EST--Y----Q--------------TMPRRGMEPH---M----SEC---CEQLEGM-------------------DESCRCEGLR---MM-MRMMQQKEMQP-R-------GEQMR-----R-------M----------MRLAENI--PSRCNLS-----------------------------
25 HHSearch 55.2130%-101 - C2 -1PSY - 2SS_RICCO A:[25-117] ----------------------------------------------------------------------------------------------------------------------------------------------------------K--D--LSSCERYL------------------RQ----SSSRRSTGEEVLRMPGDENQQQESQQ------------L----QQC---CNQVKQV-------------------RDECQCEAIK---YI-AED-Q-------IQQ-----GQ--------LHGEESERV----------AQRAGEI--VSSCGVR-----------------------------
30 HHSearch 53.6517%-118 - C2 -1W2Q - CONG_ARAHY A:[23-114] ----------------------------------------------------------------------------------------------------------------------------------------------------------V--N--LKPCEQHI------------------MQ----RIMG-EQE--QY-------------DSYDIRSTRSSDQQ----QRC---CDELNEME----------------N-TQGCMCEALQ---QI-MEN-Q-------CDRLQ---D---------R-------QMVQQF-----KRELMSL--PQQCNFRA-----P----------------------
20 HHSearch 53.0019%-150 - C2 -1B1U - IAAT_ELECO A:[15-109] ----------------------------------------------------------------------------------------------------------------------------------------------------------N--P--LDSCRWYV------------------STRTCGV----G----PRLATQE--------M------------K----ARC---CRQLEAI-------------------PAYCRCEAVR---IL-MDG-V-------VTPS----GQHEGRLLQDL-------PGCPRQVQRA-FAPKLVT--EVECNLAT-----IH---------------------
34 SP3 51.8314%-160 - C2 -1HSS - IAA1_WHEAT A:[5-124] --------------------------------------------------------------------------------------------------------------------------------------------MCYPGQAFQ----VP--A--LPACRPLL------------------RLQCN-G----S----Q--------------V------------PEAVLRDC---CQQLAHI-------------------SEWCRCGALY---SM-LDS-MYKEHGAFP-------R---------C-------RREVV------KLTAASI--TAVCRLPI-----V--VDASGDGAYVCKDVAAYPDA
17 HHSearch 50.8621%-123 - C2 -2RKN DIRL1_ARATH A:[3-75] ---------------------------------------------------------------------------------------------------------------------------------------------------DLCGMSQD--E--LNECKPAV------------------SK----E----NPT--S--------------P------------S----QPC---CTALQHA-------------------DFACLCGYKN---SPWLGS-F---------------G---------V-------D----------PELASAL--PKQCGLAN-----AP---------------------
2 Fugue 49.4522% -85 - C2 -2RKN DIRL1_ARATH A:[1-77] -------------------------------------------------------------------------------------------------------------------------------------------------AIDLCGMSQD--E--LNECKPAV------------------SK----E----N----P--------------T------------SPS--QPC---CTALQHA-------------------DFACLCGYKN---SP-WLG-S-------F-------G---------V-------D----------PELASAL--PKQCGLAN-----A------PTC-------------
27 HHSearch 49.1323%-140 - C2 -1S6D - 2SS8_HELAN A:[19-97] ----------------------------------------------------------------------------------------------------------------------------------------------------------E--M--LNHCGMYL------------------MK----NLGERS----QVSPRMREED-----H------------K----QLC---CMQLKNLD-------------------EKCMCPAIM---MM-LNE-P-------MW------IRMRD-----Q-------V----------MSMAHNL--PIECNLM-----------------------------
24 HHSearch 41.6922%-110 - C2 -3OB4 - ? A:[427-485] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------H------------Q----ERC---CNELNEFEN-----------------NQRCMCEALQ---QI-MEN-QSDRL---Q-------G---------R-------QQEQQF-----KRELRNL--PQQCGLRA-----P----------------------
10 Fugue 41.4215% -75 - C2 -1W2Q - CONG_ARAHY A:[1-127] --------------------------------------------------------------------------------------------------------------------------------------GPMRRERGRQGDSSSCERQVD--RVNLKPCEQHIMQRIMGEQEQYDSYDIRSTR----S----S----D--------------Q------------Q----QRC---CDELNEMENTQG-----------CMCEALQQIMENQCDRLQ-DRQ-M-------V-------Q---------Q-------F----------KRELMSL--PQQCNFRA-----PQRCDLDVSGGRCS---------
19 HHSearch 41.3821% -94 - C2 -1N89 NLT2G_WHEAT A:[4-65] ---------------------------------------------------------------------------------------------------------------------------------------------------------AS--Q--LAVCASAI------------------LS----G----A----K--------------P------------S----GEC---CGNLRA----------------------QQGCFCQY---AK-DPT-YG------Q-------Y---------I-------R----------SPHARDT--LTSCGLAV-----P----------------------
35 SP3 40.568%-116 * C3 *1O4U - ? A:[1-273] MEKILDLLMSFVKEDEGKLDLASFPLRNTTAGAHLLLKTENVVASGIEVSRMFLEKMGLLSKFNVEDGEYLEGTGVIGEIEGNTYKLLVAERTLLNVLSVMFSVATTTRRFAEKLKHAKIAATRKILPGLGVLQKIAVVHGGGDCVMIKDNHLKMYGS--AERAVQEV------------------RK----I----I----P--------------F------------T----TKIEVEVENLEDALRAVEAGADIVMLDNLSPEEVKDISRRIK---DI-NPN-V-------IVEVSG--G---------I-------T----------EENVSLY---DFETVDVISSSRLTLQEVFVD---LSLEIQR----


User Run . : Multi Template Modeling Result:

(5 SA) .........10........20........30........40........50........60........70........80........90....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) TIQCGTVTSTLAQCLTYLTNSGPLPSQCCVGVKSLYQLAQTTPDRKQVCECLKLAGKEIKGLNTDLVAALPTTCGVSIPYPISFSTNCDSISTAV
40 99.09100%-162 - C- -M040 - A:[1-95] TIQCGTVTSTLAQCLTYLTNSGPLPSQCCVGVKSLYQLAQTTPDRKQVCECLKLAGKEIKGLNTDLVAALPTTCGVSIPYPISFSTNCDSISTAV
41 98.07100%-165 - C- -M041 - A:[1-95] TIQCGTVTSTLAQCLTYLTNSGPLPSQCCVGVKSLYQLAQTTPDRKQVCECLKLAGKEIKGLNTDLVAALPTTCGVSIPYPISFSTNCDSISTAV
44 94.03100%-156 - C- -M044 - A:[1-96] TIQCGTVTSTLAQCLTYLTNSGPLPSQCCVGVKSLYQLAQTTPDRKQVCECLKLAGKEIKGLNTDLVAALPTTCGVSIPYPISFSTNCDSISTAV
46 92.79100%-154 - C- -M046 - A:[1-96] TIQCGTVTSTLAQCLTYLTNSGPLPSQCCVGVKSLYQLAQTTPDRKQVCECLKLAGKEIKGLNTDLVAALPTTCGVSIPYPISFSTNCDSISTAV
47 92.33100%-162 - C- -M047 - A:[1-96] TIQCGTVTSTLAQCLTYLTNSGPLPSQCCVGVKSLYQLAQTTPDRKQVCECLKLAGKEIKGLNTDLVAALPTTCGVSIPYPISFSTNCDSISTAV