@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : 086_tII_WHEAT: (2014-05-01 )
ACQASQLAVCASAILSGAKPSGECCGNLRAQQGCFCQYAKDPNYGQYIRSPHARDTLHSCGLAVPHC

Atome Classification :

(20 SA) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------..-----.--....-..10----------....--.--..--.--.-20-----------........-----------30----------.-----.-....---------...40---..-.------------....--------..50-...-......-----------60....---------..------------------------------------------------------------------------------------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AC-----Q--ASQL-AVC-----------ASAI--L--SG--A--K-PS-----------GECCGNLR-----------A-----------Q-----Q-GCFC---------QYAK----DP-N------------YGQY--------IRS--PHA-RDTLHS-----------CGLAVP---------HC------------------------------------------------------------------------------------
1 HHSearch 95.4697%-126 - C5 -1N89 NLT2G_WHEAT A:[1-67] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AC-----Q--ASQL-AVC-----------ASAI--L--SG--A--K-PS-----------GECCGNLR-----------A-----------Q-----Q-GCFC---------QYAK----DP-T------------YGQY--------IRS--PHA-RDTLTS-----------CGLAVP---------HC------------------------------------------------------------------------------------
2 HHSearch 76.8060%-138 - C5 -1L6H - NLTPX_ORYSJ A:[2-68] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GC-----N--AGQL-TVC-----------TGAI--A--GG--A--R-PT-----------AACCSSLR-----------A-----------Q-----Q-GCFC---------QFAK----DP-R------------YGRY--------VNS--PNA-RKAVSS-----------CGIALP---------TC------------------------------------------------------------------------------------
26 SP3 76.5459%-137 - C5 -1L6H - NLTPX_ORYSJ A:[1-69] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AGC-----N--AGQL-TVC-----------TGAI--A--GG--A--R-PT-----------AACCSSLR-----------A-----------Q-----Q-GCFC---------QFAK----DP-R------------YGRY--------VNS--PNA-RKAVSS-----------CGIALP---------TCH-----------------------------------------------------------------------------------
16 Fugue 76.5459%-137 - C5 -1L6H - NLTPX_ORYSJ A:[1-69] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AGC-----N--AGQL-TVC-----------TGAI--A--GG--A--R-PT-----------AACCSSLR-----------A-----------Q-----Q-GCFC---------QFAK----DP-R------------YGRY--------VNS--PNA-RKAVSS-----------CGIALP---------TCH-----------------------------------------------------------------------------------
34 SP3 69.5422%-153 - C5 -1S6D - 2SS8_HELAN A:[1-103] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PYGRGRTESGCYQQMEE--AEML-NHC-----------GMYL--MKNLG--E--R-SQVSPRMREEDHKQLCCMQLK-----------NL----------D-----E-KCMC---------PAIMMMLNEP-M------------WIRM--------RDQVMSMA-HNLPIE-----------CNLMSQ---------PCQM----------------------------------------------------------------------------------
17 Fugue 67.6931%-120 - C5 -2RKN DIRL1_ARATH A:[1-77] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AIDLCGM---S--QDEL-NEC-----------KPAV--S--KENPT--S-PS-----------QPCCTALQH----------A-----------D-----F-ACLC---------GYKN----SP-W------------LGSFG-------VDP--ELA-SALPKQ-----------CGLANAP--------TC------------------------------------------------------------------------------------
3 HHSearch 60.1330%-110 - C5 -2RKN DIRL1_ARATH A:[9-77] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QDEL-NEC-----------KPAV--S--KE--NPTS-PS-----------QPCCTALQ-----------H-----------A-----DFACLC---------GYKN----SP-W------------LGSFG-------VDP--ELA-SALPKQ-----------CGLANAP--------TC------------------------------------------------------------------------------------
8 HHSearch 57.7228% -84 - C5 -1AFH - NLTP_MAIZE A:[9-80] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SAI-APC-----------ISYA--R--GQ--G--SGPS-----------AGCCSGVR-----------SLNNAARTTADRR-----A-ACNC-----------LK----NA-A-------------AGVSG------LNA--GNA-ASIPSK-----------CGVSIP-----------------------------------------------------------------------------------------------
9 HHSearch 56.7335% -98 - C5 -1T12 - NLTP1_TOBAC A:[9-78] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SNL-APC-----------LAYL--R--NT--G----PL-----------GRCCGGVK-----------ALVNSARTTEDRQ-----I-ACTC-----------LK----SA-A-------------GAISG------INL--GKA-AGLPST-----------CGVNIP-----------------------------------------------------------------------------------------------
18 Fugue 56.6230% -83 - C5 -1BWO NLTP1_WHEAT A:[1-90] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------IDC-----GHVDSLV-RPC-----------LSYV--Q--GG--P---GPS-----------GQCCDGVKNLHNQARSQSDR-----------Q-----S-ACNC---------LKGI----AR-G------------IHNL--------N-E--DNA-RSIPPK-----------CG--VNLPYTISLNIDCSRV---------------------------------------------------------------------------------
27 SP3 54.4325% -88 - C5 -1FK5 NLTP_MAIZE A:[1-93] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AISC-----GQVASAI-APC-----------ISYA--R--GQ--G--SGPS-----------AGCCSGVR-----------S-----------L-----N-NA-------------AR----TT-ADRRAACNCLKNAAAGVSG------LNA--GNA-ASIPSK-----------CGVSIPYTISTST--DCSRVN--------------------------------------------------------------------------------
7 HHSearch 51.3928% -83 - C5 -2ALG NLTP1_PRUPE A:[9-79] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SSL-APC-----------IPYV--R--GG--G--A-VP-----------PACCNGIR-----------NVNNLARTTPDRQ-----A-ACNC-----------LK----QL-S-------------ASVPG------VNP--NNA-AALPGK-----------CGVSIP-----------------------------------------------------------------------------------------------
5 HHSearch 49.2723% -71 - C5 -1SIY - NLTP1_VIGRR A:[7-78] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QGNL-AQC-----------IGFL--Q--KG--G--V-VP-----------PSCCTGVK-----------NILNSSRTTADRR-----A-VCSC---------LKAA----AG-A------------VR-G--------INP--NNA-EALPGK-----------CGVNIP-----------------------------------------------------------------------------------------------
4 HHSearch 49.0828% -55 - C5 -1BWO NLTP1_WHEAT A:[7-78] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DSLV-RPC-----------LSYV--Q--GG--P--G-PS-----------GQCCDGVK-----------NLHNQARSQSDRQ-----S-ACNC---------LKGI----AR-G------------IH-N--------LNE--DNA-RSIPPK-----------CGVNLP-----------------------------------------------------------------------------------------------
11 HHSearch 48.3823%-101 - C5 -1HYP - HPSE_SOYBN A:[10-73] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DL-SIC-----------LNILGGS--LG--T-----V-----------DDCCALIG-----------G-----------LGDIEAI-VCLC---------IQLR----A---------------LGI---------LNL--NRNLQLILNS-----------CGRSYP---------S-------------------------------------------------------------------------------------
29 SP3 46.7016% -91 - C3 -1U78 - TC3A_CAEEL A:[2-104] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PRGSAL-----S--DTER-AQ------------LDVM--K--LL--N--V-SL-----------HEMSRKIS-----------R-----------S-----R-HCIR---------VYLK----DPVS------------YGTSKRAPRRKALSV--RDE-RNVIRA-----------ASNSCK---------TARDIRNELQLSASKRTILNVIKRSG------------------------------------------------------------
21 Fugue 46.5914%-104 * C3 *1DIK - ? ?:[2-376] AKWVYKFEEGNASMRNLLGGKGCNLAEMTILGMPIPQGFTVTTEACTEYYNSGKQITQEIQDQIFEAITWLEELNGKKFGDTEDPLLVSVRSAARASMPGMMDTILNLGLNDVAVEGFAKKTGNPRFAYDSYRRFIQMYSDVVMEVPKSHFEKIIDAMKEEKGVHFDTDLTADDLKELAEKFKAVYKEAMNGEEFPQEPKDQLMGAVKAVFRSWDNPRAI-----V--YRRM-NDI-----------PGDW--G--TA--V--N-VQ-----------TMVFGNKG-----------E-----------T-----S-GTGV---------AFTR----NP-STGEKGI------YGEY--------LIN--AQG-EDVVAG-----------VRTPQP---------ITQLENDMPDCYKQFMDLAMKLEKHFRDMQDMEFTIEEGKLYFLQTRNGKRTAPAALQIACDLVDEGMITEEEAVVRIEAKSLDQL
20 Fugue 45.1527% -78 - C1 -1CWV - A:[393-492] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------NRWIYDGGRSLVSSLEASRQC-----Q--GSDMSAVL-----------ESSR--A--TN--G--T-RA-----------PD--GTLW-----------G-----------E-----W-GSLT---------AYSS----DW-Q------------SGEY--------WVK--KTS-TDFETMNMDTGALQPGPAYLAFP---------LCALSI--------------------------------------------------------------------------------
25 Fugue 44.8918% -81 - C5 -1Q1V - DEK_HUMAN A:[309-378] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DEPLIKKLKKPP-----T--DEEL-KET-----------IKKL--L--AS--A--N-----------------LEEVT-----------M-----------K-----Q-ICKK---------VYEN----YP-T------------YDLT--------ERK--DFI-KTTVKE-----------L-ISLE---------H-------------------------------------------------------------------------------------
19 Fugue 43.2621%-108 * C7 *2KSS - CARS_MYXXA A:[21-106] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MI-----Q--DPSL-IICHDVDGAPVRIGAKVK--V--VP--H--S-ED-----------GTISQRFL-----------G-----------Q-----T-GIVVGLVFDDPATQYPD----DP-L------------I-QV--------LVE--GLG-EDLFFP-----------EELELA---------PE------------------------------------------------------------------------------------


User Run . : Multi Template Modeling Result:

(3 SA) .........10........20........30........40........50........60......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) ACQASQLAVCASAILSGAKPSGECCGNLRAQQGCFCQYAKDPNYGQYIRSPHARDTLHSCGLAVPHC
40 90.56100%-119 - C- -M040 - A:[1-92] ACQASQLAVCASAILSGAKPSGECCGNLRAQQGCFCQYAKDPNYGQYIRSPHARDTLHSCGLAVPHC
43 90.25100%-118 - C- -M043 - A:[1-128] ACQASQLAVCASAILSGAKPSGECCGNLRAQQGCFCQYAKDPNYGQYIRSPHARDTLHSCGLAVPHC
42 88.52100%-122 - C- -M042 - A:[1-128] ACQASQLAVCASAILSGAKPSGECCGNLRAQQGCFCQYAKDPNYGQYIRSPHARDTLHSCGLAVPHC