@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : new_query: (2014-05-05 )
LSCGQVQSGLAPCLPYLQGRGPLGSCCGGVKGLLGAAKSLSDRKTACTCLKSAANAIKGIDMGKAAGLPGACGVNIPYKISPSTDCSKVQ

Atome Classification :

(20 SA) -------------......--...10.......----.----20.-------------------.----------------.......30......-----------------..40........50-...-....----.-------.---------60--------.-----------.......--.70........---80........90
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) -------------LSCGQV--QSGLAPCLPYLQ----G----R-G-------------------P----------------LGSCCGGVKGLLGAA-----------------KSLSDRKTACTCL--KSA-ANAI----K-------G---------I---------D-----------MGKAAGL--PGACGVNIPYK---ISPSTDCSKVQ
11 HHSearch 94.1372%-132 - C3 -1T12 - NLTP1_TOBAC A:[2-91] -------------ITCGQV--TSNLAPCLAYLR----N----T-G-------------------P----------------LGRCCGGVKALVNSA-----------------RTTEDRQIACTCL--KSA-AGAI----S-------G---------I---------N-----------LGKAAGL--PSTCGVNIPYK---ISPSTDCSKVQ
13 HHSearch 83.5151%-122 - C3 -1SIY - NLTP1_VIGRR A:[1-91] -------------MTCGQV--QGNLAQCIGFLQ----K----G-GV------------------V----------------PPSCCTGVKNILNSS-----------------RTTADRRAVCSCL--KAA-AGAV----R-------G---------I---------N-----------PNNAEAL--PGKCGVNIPYK---ISTSTNCNSIN
16 HHSearch 82.4351%-127 - C3 -1BWO NLTP1_WHEAT A:[1-90] -------------IDCGHV--DSLVRPCLSYVQ----G----GPG-------------------P----------------SGQCCDGVKNLHNQA-----------------RSQSDRQSACNCL--KGI-ARGI----H-------N---------L---------N-----------EDNARSI--PPKCGVNLPYT---ISLNIDCSRV-
15 HHSearch 80.8448%-130 - C3 -2ALG NLTP1_PRUPE A:[2-92] -------------ITCGQV--SSSLAPCIPYVR----G----G-GA------------------V----------------PPACCNGIRNVNNLA-----------------RTTPDRQAACNCL--KQL-SASV----P-------G---------V---------N-----------PNNAAAL--PGKCGVSIPYK---ISASTNCATVK
30 SP3 78.4053%-125 - C3 -1FK5 NLTP_MAIZE A:[1-93] ------------AISCGQV--ASAIAPCISYAR----G----Q-GSG-----------------P----------------SAGCCSGVRSLNNAA-----------------RTTADRRAACNCL--KNA-AAGV----S-------G---------L---------N-----------AGNAASI--PSKCGVSIPYT---ISTSTDCSRVN
12 HHSearch 76.3953%-110 - C3 -1AFH - NLTP_MAIZE A:[2-93] -------------ISCGQV--ASAIAPCISYAR----G----Q-GSG-----------------P----------------SAGCCSGVRSLNNAA-----------------RTTADRRAACNCL--KNA-AAGV----S-------G---------L---------N-----------AGNAASI--PSKCGVSIPYT---ISTSTDCSRVN
23 HHSearch 54.6926%-161 - C3 -1BEA - ITRF_MAIZE A:[15-109] ----------------------NPLPSCRWYVTSRTCG----I-G-------------------PRLPWPEL---------KRRCCRELADI-------------------------PAYCRCTAL--SIL-MDGA----IPPGPDAQLEGR------L---------EDLPGCPREVQ-RGFAATLVTEAECNLATI----------------
24 HHSearch 53.5826%-129 - C3 -1SM7 - ? A:[13-101] ----------------------QHLRACQQWIR----QQLA-G-S-------------------PFSENQWGPQQGPSL--REQCCNELYQE-------------------------DQVCVCPTL--KQA-AKSV----RVQ-----GQ--------H---------GPFQSTRI----YQIAKNL--PNVCNMKQI----------------
21 HHSearch 46.6617%-138 - C3 -1B1U - IAAT_ELECO A:[15-109] ----------------------NPLDSCRWYVSTRTCG----V-G-------------------PRLATQEM---------KARCCRQLEAI-------------------------PAYCRCEAV--RIL-MDGV----VTPS----GQHEGRLLQDLPGCPRQVQRA-----------FAPKLVT--EVECNLATIH---------------
17 HHSearch 45.5828%-104 - C3 -2RKN DIRL1_ARATH A:[4-75] --------------LCGMS--QDELNECKPAVS----K----E-NPTS----------------P----------------SQPCCTALQHA-------------------------DFACLCGYK--NSPWLGSF------------G---------V---------D-----------PELASAL--PKQCGLANAP---------------
26 HHSearch 45.4428%-102 - C3 -1PSY - 2SS_RICCO A:[25-118] ----------------------KDLSSCERYLR----QSSSRR-STGE----------------EVLRMPGDENQQQESQQLQQCCNQVKQV-------------------------RDECQCEAI--KYI-AEDQ----IQQG----Q---------LHGEESER--V-----------AQRAGEI--VSSCGVRC-----------------
28 HHSearch 44.7928%-113 - C3 -1S6D - 2SS8_HELAN A:[19-97] ----------------------EMLNHCGMYLM----KNLGER-S-------------------QVSPRMREEDH------KQLCCMQLKNLDE-------------------------KCMCPAI--MMM-LNEP----M-------WIRMRD----Q---------V-----------MSMAHNL--PIECNLM------------------
2 Fugue 42.9327% -77 - C3 -2RKN DIRL1_ARATH A:[1-77] -----------AIDLCGMS--QDELNECKPAVS----K----E-NPTS----------------P----------------SQPCCTALQHA-------------------------DFACLCGYK--NSP-WLGS----F-------G---------V---------D-----------PELASAL--PKQCGLANA---------PTC----
25 HHSearch 42.7620% -98 - C3 -3OB4 - ? A:[428-485] ---------------------------------------------------------------------------------QERCCNELNEFEN-----------------------NQRCMCEAL--QQI-MENQSDRLQ-------G---------R---------QQEQQF------KRELRNL--PQQCGLRAP----------------
4 Fugue 40.8720% -91 - C3 -1L6H - NLTPX_ORYSJ A:[1-69] -------------AGC--N--AGQLTVCTGAIAG---G----A-R-------------------P----------------TAACCSSLR----------------------------AQQGCFCQF-AKD-PRYG----R-------Y---------V---------N-----------SPNARKA--VSSCGIALPT----------CH---
6 Fugue 38.5419% -55 - C3 -1S6D - 2SS8_HELAN A:[1-103] ---------------PYGR--GRTESGCYQQME----E----A-E-------------------M----------------LNHCGMYLMKNLGERSQVSPRMREEDHKQLCCMQLKNLDEKCMC---PAI-MMML----N-------E---------P---------MWIRMRDQV---MSMAHNL--PIECNLM----------SQPCQM--
5 Fugue 38.0321% -52 - C3 -1W2Q - CONG_ARAHY A:[1-127] GPMRRERGRQGDSSSCERQVDRVNLKPCEQHIM----Q----R-IMGEQEQYDSYDIRSTRSSDQ----------------QQRCCDELNEM-------------------------ENTQGCMCE--ALQ-QIME----N-------Q---------C---------DRLQDRQMVQQFKRELMSL--PQQCNFRAPQRCDLDVSGGRCS---
19 HHSearch 35.1229% -49 - C3 -1N89 NLT2G_WHEAT A:[4-65] ---------------------ASQLAVCASAIL----S----G-AK------------------P----------------SGECCGNLRA----------------------------QQGCFCQYAKDP-TYG-----Q-------Y---------I---------R-----------SPHARDT--LTSCGLAVP----------------
20 HHSearch 31.9927% -69 - C3 -1PNB - ? B:[13-67] -----------------------------------------------------------------------------------QCCNELYQE-------------------------DQVCVCPTL--KQA-AKSV----RVQGQHG-PFQST-----R---------I-----------YQIAKNL--PNVCNMKQI----------------
18 HHSearch 31.2723% -80 - C3 -1L6H - NLTPX_ORYSJ A:[6-66] ----------------------GQLTVCTGAIA----G----G-AR------------------P----------------TAACCSSLRA----------------------------QQGCFCQFAKDPRYGR-------------Y---------V---------N-----------SPNARKA--VSSCGIALP----------------


User Run . : Multi Template Modeling Result:

(3 SA) .........10........20........30........40........50........60........70........80........90
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) LSCGQVQSGLAPCLPYLQGRGPLGSCCGGVKGLLGAAKSLSDRKTACTCLKSAANAIKGIDMGKAAGLPGACGVNIPYKISPSTDCSKVQ
35 97.61100%-147 - C- -M035 - A:[1-94] LSCGQVQSGLAPCLPYLQGRGPLGSCCGGVKGLLGAAKSLSDRKTACTCLKSAANAIKGIDMGKAAGLPGACGVNIPYKISPSTDCSKVQ
37 94.29100%-135 - C- -M037 - A:[1-148] LSCGQVQSGLAPCLPYLQGRGPLGSCCGGVKGLLGAAKSLSDRKTACTCLKSAANAIKGIDMGKAAGLPGACGVNIPYKISPSTDCSKVQ
36 93.69100%-131 - C- -M036 - A:[1-148] LSCGQVQSGLAPCLPYLQGRGPLGSCCGGVKGLLGAAKSLSDRKTACTCLKSAANAIKGIDMGKAAGLPGACGVNIPYKISPSTDCSKVQ