@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : 449_tII_MAIZE: (2014-05-08 )
ATACDAAQLTPCAGAIIGSSPPTAACCSRLREQQPCLCTYARDPKLQRYVSSPNGKNAMAACKVPVPSC

Atome Classification :

(20 SA) --------------------------------------------------------------------------------------------------------------------------------....--.--..--..---10--...-----..--.-..20-.--.-----.......30.-----------.------.-...--..40--..-.-.------------....--------50-------....-....60..--------..-..-------..-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) --------------------------------------------------------------------------------------------------------------------------------ATAC--D--AA--QL---TP--CAG-----AI--I-GSS--P--P-----TAACCSRLRE-----------Q------Q-PCL--CTYA--RD-P-K------------LQRY--------VS-------SPNG-KNAMAACK--------VP-VP-------SC-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
28 SP3 92.7452%-118 - C4 -1L6H - NLTPX_ORYSJ A:[1-69] ---------------------------------------------------------------------------------------------------------------------------------AGC--N--AG--QL---TV--CTG-----AI--A-GGA--R--P-----TAACCSSLRA-----------Q------Q-GCF--CQFA--KD-P-R------------YGRY--------VN-------SPNA-RKAVSSCG--------IA-LP-------TCH------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
18 Fugue 92.7452%-118 - C4 -1L6H - NLTPX_ORYSJ A:[1-69] ---------------------------------------------------------------------------------------------------------------------------------AGC--N--AG--QL---TV--CTG-----AI--A-GGA--R--P-----TAACCSSLRA-----------Q------Q-GCF--CQFA--KD-P-R------------YGRY--------VN-------SPNA-RKAVSSCG--------IA-LP-------TCH------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
2 HHSearch 92.5453%-118 - C4 -1L6H - NLTPX_ORYSJ A:[1-68] ---------------------------------------------------------------------------------------------------------------------------------AGC--N--AG--QL---TV--CTG-----AI--A-GGA--R--P-----TAACCSSLRA-----------Q------Q-GCF--CQFA--KD-P-R------------YGRY--------VN-------SPNA-RKAVSSCG--------IA-LP-------TC-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
1 HHSearch 87.2343%-115 - C4 -1N89 NLT2G_WHEAT A:[1-67] ----------------------------------------------------------------------------------------------------------------------------------AC--Q--AS--QL---AV--CAS-----AI--L-SGA--K--P-----SGECCGNLRA-----------Q------Q-GCF--CQYA--KD-P-T------------YGQY--------IR-------SPHA-RDTLTSCG--------LA-VP-------HC-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
19 Fugue 69.3926% -92 - C4 -2RKN DIRL1_ARATH A:[1-77] -------------------------------------------------------------------------------------------------------------------------------AIDLCGMS--QD--EL---NE--CKP-----AV--S-KEN--PTSP-----SQPCCTALQHA----------D------F-ACL--CGYK--NS-P-W------------LGSFG-------VD-------PELA-SALPKQCG--------LA-NAP------TC-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
29 SP3 67.0327% -66 - C4 -1FK5 NLTP_MAIZE A:[1-93] --------------------------------------------------------------------------------------------------------------------------------AISC--GQVAS--AI---AP--CIS-----YA--R-GQG--SG-P-----SAGCCSGVRS-----------L------N-NA------A--RT-T-ADRRAACNCLKNAAAGVSG------LN-------AGNA-ASIPSKCG--------VS-IPYTISTSTDCSRVN---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
3 HHSearch 63.8925% -97 - C4 -2RKN DIRL1_ARATH A:[9-77] -----------------------------------------------------------------------------------------------------------------------------------------QD--EL---NE--CKP-----AV--S-KENPTS--P-----SQPCCTALQH-----------A------DFACL--CGYK--NS-P-W------------LGSFG-------VD-------PELA-SALPKQCG--------LA-NAP------TC-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
5 HHSearch 63.3027% -66 - C4 -2ALG NLTP1_PRUPE A:[1-79] --------------------------------------------------------------------------------------------------------------------------------MITC--G--QVSSSL---AP--CIP-----YV--R-GGG--A--V-----PPACCNGIRNVNNLARTTPDRQ------A-ACN--C--L--KQ-L-S-------------ASVPG------VN-------PNNA-AALPGKCG--------VS-IP----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
7 HHSearch 62.8427% -68 - C4 -1AFH - NLTP_MAIZE A:[1-80] --------------------------------------------------------------------------------------------------------------------------------AISC--G--QVASAI---AP--CIS-----YA--R-GQG--SG-P-----SAGCCSGVRSLNNAARTTADRR------A-ACN--C--L--KN-A-A-------------AGVSG------LN-------AGNA-ASIPSKCG--------VS-IP----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
8 HHSearch 60.4820% -70 - C4 -1SIY - NLTP1_VIGRR A:[7-78] -----------------------------------------------------------------------------------------------------------------------------------------QG--NL---AQ--CIG-----FL--Q-KGG--V--V-----PPSCCTGVKNILNSSRTTADRR------A-VCS--CLKA--AA-G-A------------VR-G--------IN-------PNNA-EALPGKCG--------VN-IP----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
9 HHSearch 59.9422% -74 - C4 -1T12 - NLTP1_TOBAC A:[1-78] --------------------------------------------------------------------------------------------------------------------------------AITC--G--QVTSNL---AP--CLA-----YL--R-NTG-----P-----LGRCCGGVKALVNSARTTEDRQ------I-ACT--C--L--KS-A-A-------------GAISG------IN-------LGKA-AGLPSTCG--------VN-IP----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
4 HHSearch 59.0221% -58 - C4 -1BWO NLTP1_WHEAT A:[7-78] -----------------------------------------------------------------------------------------------------------------------------------------DS--LV---RP--CLS-----YV--Q-GGP--G--P-----SGQCCDGVKNLHNQARSQSDRQ------S-ACN--CLKG--IA-R-G------------IH-N--------LN-------EDNA-RSIPPKCG--------VN-LP----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
11 HHSearch 56.7521% -97 - C4 -1HYP - HPSE_SOYBN A:[10-73] ---------------------------------------------------------------------------------------------------------------------------------------------DL---SI--CLN-----ILGGS-LGT-----------VDDCCALIGG-----------LGDIEA-I-VCL--CIQL--RA----------------LGI---------LN-------LNRNLQLILNSCG--------RS-YP-------S--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
31 SP3 55.6313% -72 - C4 -1PS6 PDXA_ECOLI A:[1-328] -----------------------------------------------------------------VKTQRVVITPGEPAGIGPDLVVQLAQREWPVELVVCADATLLTNRAAMLGLPLTLRPYSPNSPAQPQ--T--AG--TLTLLPV--ALR-----AP--V-TAG--Q--L-----AVENGHYVVE-----------T------L-ARA--CDGC--LN-G-E------------FAAL--------IT-------GPVH-KGVINDAG--------IP-FT-------GHTEFFEERSQAKKVVMMLATEELRVALATTHLPLRDIADAITPALLHEVIAILHHDLRTKFGIAEPRILVCGLNPHAGEGGHMGTEEIDTIIPVLNELRAQGMKLNGPLPADTLFQPKYLDNADAVLAMYHDQGLPVLKYQGFGRGVNITLGLPFIRTSVDHGTALELAGRGKADVGSFITALNLAIKMIVNTQ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
27 Fugue 54.8325% -97 - C1 -1KG1 - ? A:[1-60] --------------------------------------------------------------------------------------------------------------------------------------D--RC--RY---TL--CCD-----------GAL--K--A-----VSACL---HE-----------S------E-SCLVPGDCC--RG-K-S------------RLTL--------CS-------YGEG-GNGFQ-CP--------TG-YR-------QC-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
16 HHSearch 51.6020% -43 - C4 -3OB4 - ? A:[427-485] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------H-----QERCCNELNE-----------FEN----NQRCM--CEAL--QQ-I-M------------ENQSDRL-----QGRQQEQQFKREL-RNLPQQCG--------LR-AP----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
23 Fugue 51.3514%-109 - C6 -1VD2 - KPCI_HUMAN A:[11-99] --------------------------------------------------------------------------------------------------------------------------------GPLG--S--QV--RV---KA--YYRGDIMITH--F-EPS--I--S-----FEGLCNEVRD-----------MCSFDNEQ-LFT--MKWI--DE-E-G------------DPCT--------VS-------SQLELEEAFRLYELNKDSELLIH-VF-------PC-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
26 Fugue 50.2521% -81 - C4 -3UGM - ? A:[169-1048] KPKVRELVAHIVALSQHPAALGTVAVTYQHIITALATHEDIVGVGKQWSGARALEALLTDAGELRGPPLQLDTGQLVKIAKRGGVTAMEAVHASRNALTPLNLTPAQVVAIASNNGGKQALETVQRLLPVLC--Q--AH--GL---TP--AQV-----VA--I-ASH--D--G-----GKQALETMQR-----------L------L-PVL--CQAHGLPP-D-Q------------VVAI--------AS-------NIGG-KQALETVQ--------RL-LP-------VLCQAHGLTPDQVVAIASHGGGKQALETVQRLLPVLCQAHGLTPDQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPDQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPDQVVAIASNGGKQALETVQRLLPVLCQAHGLTPDQVVAIASHDGGKQALETVQRLLPVLCQTHGLTPAQVVAIASHDGGKQALETVQQLLPVLCQAHGLTPDQVVAIASNIGGKQALATVQRLLPVLCQAHGLTPDQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPDQVVAIASNGGGKQALETVQRLLPVLCQAHGLTQVQVVAIASNIGGKQALETVQRLLPVLCQAHGLTPAQVVAIASHDGGKQALETVQRLLPVLCQAHGLTPDQVVAIASNGGGKQALETVQRLLPGLTQEQVVAIASNNGGKQALETVQRLLPVLCQAHGLTPDQVVAIASNGGGKQALETVQRLLPVLCQAHGLTPAQVVAIASNIGGKQALETVQRLLPVLCQDHGLTLAQVVAIASNIGGKQALETVQRLLPVLCQGLTQDQVVAIASNIGGKQALETVQRLLPVLCQDHGLTPDQVVAIASNIGGKQALETVQRLLPVLCQDHGLTLDQVVAIASNGGKQALETVQRLLPVLCQDHGLTPDQVVAIASNSG
30 SP3 49.8611% -81 - C4 -1U78 - TC3A_CAEEL A:[2-104] ------------------------------------------------------------------------------------------------------------------------------PRGSAL--S--DT--ER---AQ---LD-----VM--K-LLN--V--S-----LHEMSRKISR-----------S------R-HCI--RVYL--KD-PVS------------YGTSKRAPRRKALS-------VRDE-RNVIRAAS--------NS-CK-------TARDIRNELQLSASKRTILNVIKRSG-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
32 SP3 47.4811% -88 * C4 *1F9M - TRXF_SPIOL A:[10-121] ------------------------------------------------------------------------------------------------------------------------------MEAIVG--K--VT--EV---NKDTFWP-----IV--KAAGD--K--PVVLDMFTQWCGPCKA-----------M------A-PKY--EKLA--EEYL-DVI----------FLKL--------DC-------NQEN-KTLAKELG--------IRVVP-------TFKILKENSVVGEVTGAKYDKLLEAIQAARS--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------


User Run . : Multi Template Modeling Result:

(2 SA) .........10........20........30........40........50........60........
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) ATACDAAQLTPCAGAIIGSSPPTAACCSRLREQQPCLCTYARDPKLQRYVSSPNGKNAMAACKVPVPSC
42 100.00100%-120 - C- -M042 - A:[1-215] ATACDAAQLTPCAGAIIGSSPPTAACCSRLREQQPCLCTYARDPKLQRYVSSPNGKNAMAACKVPVPSC
43 99.28100%-115 - C- -M043 - A:[1-215] ATACDAAQLTPCAGAIIGSSPPTAACCSRLREQQPCLCTYARDPKLQRYVSSPNGKNAMAACKVPVPSC