@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : 627_tVI_THECC: (2014-05-12 )
QSAAECKQERKILVNACKAVITRKPPTPYCCERLRVTHVSCVCPVITPQLAALIDVNYAIKVIQGCGIQVPRHSKCGSITTP

Atome Classification :

(20 SA) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------.........10.--.--.......20-------------.---.-----.--------------.---------.----------.-..30-----.....--------...----------.----------40......-..--50.--.--.-------------..------------...60........70----........80.---------------------------------------------------------------------------------------------------------------------------------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QSAAECKQER-K--I--LVNACKAVI-------------T---R-----K--------------P---------P----------T-PYC------CERLR--------VTH----------V----------SCVCPVIT-PQ--LAA--L--I-------------DV------------NYAIKVIQGCGIQVP----RHSKCGSITTP---------------------------------------------------------------------------------------------------------------------------------
14 HHSearch 83.1324%-138 - C5 -1T12 - NLTP1_TOBAC A:[3-90] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TCGQVT-S--N--L-APCLAYL-------------R---N-----T--------------G---------P----------L-GRC------CGGVK--------ALV----------NSARTTEDRQIACTC--LK-SA--AGA--ISGI-------------NL------------GKAAGLPSTCGVNIPYKISPSTDCSKV------------------------------------------------------------------------------------------------------------------------------------
19 HHSearch 77.8225%-104 - C5 -1SIY - NLTP1_VIGRR A:[3-90] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------CGQVQ-G--N--L-AQCIGFL-------------Q---K-----GG-------------V---------V----------P-PSC------CTGVK--------NIL----------NSSRTTADRRAVCSCLKAA-AG--AVR--G--I-------------NP------------NNAEALPGKCGVNIPYKISTSTNCNSI------------------------------------------------------------------------------------------------------------------------------------
18 HHSearch 76.3024%-127 - C5 -2ALG NLTP1_PRUPE A:[3-91] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------TCGQVS-S--S--L-APCIPYV-------------R---GG----G--------------A---------V----------P-PAC------CNGIR--------NVNNLARTTPDRQA----------ACNC--LK-QL--SASVPG--V-------------NP------------NNAAALPGKCGVSIPYKISASTNCATV------------------------------------------------------------------------------------------------------------------------------------
25 HHSearch 75.4723%-132 - C5 -1SM7 - ? A:[3-103] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QKCQREF-Q--QEQHLRACQQWI-------------R---Q-----QLAGS----------PFSENQWG--PQQGPSL----R-EQC------CNELY--------QED----------Q----------VCVCPTLK-QA--AKS--V--RVQGQHGPFQSTR-IY------------QIAKNLPNVCNMKQI----GT------------------------------------------------------------------------------------------------------------------------------------------
1 Fugue 73.2220%-119 - C5 -2RKN DIRL1_ARATH A:[1-77] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AIDLCGMS--Q--D--ELNECKPAV-------------SKENP-----T--------------S---------P----------S-QPC------CTALQ--------HAD----------F----------ACLCGYKN-SP--WLG--SFGV-------------DP------------ELASALPKQCGLANA------PTC---------------------------------------------------------------------------------------------------------------------------------------
17 HHSearch 72.8921%-126 - C5 -1AFH - NLTP_MAIZE A:[3-92] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SCGQVA-S--A--I-APCISYA-------------R---G-----QG-------------SG--------P----------S-AGC------CSGVR--------SLN----------NAARTTADRRAACNC--LK-NA--AAGVSG--L-------------NA------------GNAASIPSKCGVSIPYTISTSTDCSRV------------------------------------------------------------------------------------------------------------------------------------
5 Fugue 72.7318% -88 - C5 -1S6D - 2SS8_HELAN A:[1-103] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PYGRGRTESGCYQQM-E--EAEMLNHCGMYL-------------M---K-----NLGERSQVSPRMREED---------H----------K-QLC------CMQLK--------NLD----------E----------KCMCPAIM-MM--LNE--P--M-------------WI------------RMRDQVMSMAHNLPI----E---CNLMSQPCQM------------------------------------------------------------------------------------------------------------------------------
32 SP3 72.4518%-119 - C5 -1FK5 NLTP_MAIZE A:[1-93] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AISCGQVA-S--A--I-APCISYA-------------R---GQG---S--------------G---------P----------S-AGC------CSGVRSLNNAARTTAD----------R----------RAACNCLK-NA--AAG--VSGL-------------NA------------GNAASIPSKCGVSIPYTISTSTDCSRVN-----------------------------------------------------------------------------------------------------------------------------------
16 HHSearch 70.6818% -95 - C5 -1BWO NLTP1_WHEAT A:[2-89] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DCGHVD-S--L--V-RPCLSYV-------------Q---G-----GP-------------G---------P----------S-GQC------CDGVK--------NLH----------NQARSQSDRQSACNCLKGI-AR--GIH--N--L-------------NE------------DNARSIPPKCGVNLPYTISLNIDCSR-------------------------------------------------------------------------------------------------------------------------------------
38 SP3 69.6017%-139 * C5 *1S6D - 2SS8_HELAN A:[1-103] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PYGRGRTESGCYQQM-EEAE--MLNHCGMYLMKNLGERSQVSPRM---R-----E--------------E---------D----------HKQLC------CMQLK--------NLD----------E----------KCMC-----PA--IMM--M--LNEPMWIR------MR------------DQVMSMA----HNLP------IECNLMSQPCQM------------------------------------------------------------------------------------------------------------------------------
12 HHSearch 69.4028%-156 - C5 -1N89 NLT2G_WHEAT A:[7-65] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LAVCASAI-------------L---SG----A--------------K---------P----------S-GEC------CGNLR--------AQQ---------------------GCFCQYAKDPT--YGQ--Y--I-------------RS------------PHARDTLTSCGLAVP------------------------------------------------------------------------------------------------------------------------------------------------
11 HHSearch 68.2824%-125 - C5 -2RKN DIRL1_ARATH A:[3-75] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DLCGMSQ-D--E--L-NECKPAV-------------S---K-----ENPT-----------S---------P----------S-QPC------CTALQ--------HAD----------F----------ACLCGYKN-SPW-LGSF-G--V-------------DP------------ELASALPKQCGLANA----P-------------------------------------------------------------------------------------------------------------------------------------------
23 HHSearch 67.0622%-122 - C5 -1S6D - 2SS8_HELAN A:[10-97] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GCYQQM-EEAE--MLNHCGMYL-------------M---K-----NLGERS---------QVSPRMREEDH----------K-QLC------CMQLK--------NLD----------E----------KCMCPAIM-MM--LNE--P--MWIRMRDQ------VM------------SMAHNLPIECNLM--------------------------------------------------------------------------------------------------------------------------------------------------
24 HHSearch 66.7018%-142 - C5 -2LVF - ? A:[5-101] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QEECREQM-QRQQ--MLSHCRMYM-------------R---QQMEEST--------------Y---------QTMPRRGMEPHM-SEC------CEQLE--------GMD----------E----------SCRCEGLR-MM--MRM--M--QQKEMQPRGEQMRRMM------------RLAENIPSRCNLS--------------------------------------------------------------------------------------------------------------------------------------------------
2 Fugue 64.4329% -88 - C5 -1L6H - NLTPX_ORYSJ A:[1-69] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AGCNAGQ--------LTVCTGAI-------------A---GG----A--------------R---------P----------T-AAC------CSSLR---------AQ----------Q----------GCFCQFAKDPR--YGR--Y--V-------------NS------------PNARKAVSSCGIALP-------TCH--------------------------------------------------------------------------------------------------------------------------------------
21 HHSearch 63.9126%-146 - C5 -2DS2 - ? B:[7-69] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------L-RQC------CNQLR--------QVD----------R----------PCVCPVLR-QA--AQQ--V--LQRQIIQGPQQLRRLF------------DAARNLPNICNIPNI----GA--CPF-------------------------------------------------------------------------------------------------------------------------------------
40 SP3 61.8914% -78 * C6 *1E1O SYK2_ECOLI A:[11-502] AIDFNDELRNRREKLAALRQQGVAFPNDFRRDHTSDQLHEEFDAKDNQELESLNIEVSVAGRMMTRRIMGKASFVTLQDVGGRIQLYVARDSLPEGVYNDQFKKWDLGDIIGARGTLFKTQTGELSIHCTELRLLTKALRPLPDQEVRYRQRYLDLIANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVHNPEFTMMELYMAYADYHDLIELT-E--S--LFRTLAQEV-------------L---G-----T--------------T---------K----------V-TYGEHVFDFGKPFE--------KLT----------M----------REAIKKYR-PETDMAD--L--D-------------NF------------DAAKALAESIGITVE----KSWGLGRIVTEIFDEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNAKAAGDDEAMFYDEDYVTALEYGLPPTAGLGIGIDRMIMLFTNSHTIRDVILFPAMRP
13 HHSearch 61.6030%-120 - C5 -1L6H - NLTPX_ORYSJ A:[8-69] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LTVCTGAI-------------A---GG----A--------------R---------P----------T-AAC------CSSLR--------AQ-----------Q----------GCFCQFAKDPR--YGR--Y--V-------------NS------------PNARKAVSSCGIALP-------TCH--------------------------------------------------------------------------------------------------------------------------------------
35 SP3 60.2014% -78 - C6 -1E1O SYK2_ECOLI A:[161-502] -----------------------------------------------------------------------------------------------------------------------------------------------DQEVRYRQRYLDLIANDKSRQTFVVRSKILAAIRQFMVARGFMEVETPMMQVIPGGASARPFITHHNALDLDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGISVHNPEFTMMELYMAYADYHDLIELT-E--S--LFRTLAQEV-------------L---G-----T--------------T---------K----------V-TYGEHVFDFGKPFE--------KLT----------M----------REAIKKYR-PETDMAD--L--D-------------NF------------DAAKALAESIGITVE----KSWGLGRIVTEIFDEVAEAHLIQPTFITEYPAEVSPLARRNDVNPEITDRFEFFIGGREIGNGFSELNDAEDQAERFQEQVNAKAAGDDEAMFYDEDYVTALEYGLPPTAGLGIGIDRMIMLFTNSHTIRDVILFPAMRP
10 Fugue 59.5522%-115 - C3 -2DBS - ? A:[7-86] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RLAELDGVLMQ--Y--LLEAD---L-------------L---R-----E--------------L---------P----------P-TY---------------------------------R----------LVLLPLDE-PE--VAA--Q--A-------------LAWAMEAPNPEGWPSVYALFLQGRPIRLL----LLGK--EVEVA---------------------------------------------------------------------------------------------------------------------------------


User Run . : Multi Template Modeling Result:

(3 SA) .........10........20........30........40........50........60........70........80.
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) QSAAECKQERKILVNACKAVITRKPPTPYCCERLRVTHVSCVCPVITPQLAALIDVNYAIKVIQGCGIQVPRHSKCGSITTP
44 53.43100% -12 - C- -M044 - A:[3-129] QSAAECKQERKILVNACKAVITRKPPTPYCCERLRVTHVSCVCPVITPQLAALIDVNYAIKVIQGCGIQVPRHSKCGSITTP
45 48.42100% 1 - C- -M045 - A:[3-129] QSAAECKQERKILVNACKAVITRKPPTPYCCERLRVTHVSCVCPVITPQLAALIDVNYAIKVIQGCGIQVPRHSKCGSITTP
47 47.14100% -22 - C- -M047 - A:[2-125] QSAAECKQERKILVNACKAVITRKPPTPYCCERLRVTHVSCVCPVITPQLAALIDVNYAIKVIQGCGIQVPRHSKCGSITTP