@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : 744_tII_VITVI: (2014-05-14 )
VTCSPQELSPCFAAFSSSAPPSSTCCSKLKEQKPCLCGYLKDPNFSQYVNSAKAKKIASTCGVQFPSC

Atome Classification :

(20 SA) ----------------------------------------------------------------...--.--.--.--..---.10....--.-...--20-.-----........30-----------..-......40---.------.-.------------..-----..--------.50...-.....60..-.-..-------..-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) ----------------------------------------------------------------VTC--S--P--Q--EL---SPCFAAF--S-SSA--P--P-----SSTCCSKLKE-----------QK-PCLCGYLK---D------P-N------------FS-----QY--------VNSAKA-KKIASTCGV-Q-FP-------SC-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
1 HHSearch 92.4639%-102 - C3 -1N89 NLT2G_WHEAT A:[1-67] -----------------------------------------------------------------AC--Q--A--S--QL---AVCASAI--L-SGA--K--P-----SGECCGNLRA-----------QQ-GCFCQYAK---D------P-T------------YG-----QY--------IRSPHA-RDTLTSCGL-A-VP-------HC-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
2 HHSearch 90.9440%-104 - C3 -1L6H - NLTPX_ORYSJ A:[1-68] ----------------------------------------------------------------AGC--N--A--G--QL---TVCTGAI--A-GGA--R--P-----TAACCSSLRA-----------QQ-GCFCQFAK---D------P-R------------YG-----RY--------VNSPNA-RKAVSSCGI-A-LP-------TC-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
25 SP3 90.3939%-104 - C3 -1L6H - NLTPX_ORYSJ A:[1-69] ----------------------------------------------------------------AGC--N--A--G--QL---TVCTGAI--A-GGA--R--P-----TAACCSSLRA-----------QQ-GCFCQFAK---D------P-R------------YG-----RY--------VNSPNA-RKAVSSCGI-A-LP-------TCH------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
15 Fugue 90.3939%-104 - C3 -1L6H - NLTPX_ORYSJ A:[1-69] ----------------------------------------------------------------AGC--N--A--G--QL---TVCTGAI--A-GGA--R--P-----TAACCSSLRA-----------QQ-GCFCQFAK---D------P-R------------YG-----RY--------VNSPNA-RKAVSSCGI-A-LP-------TCH------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
16 Fugue 88.6635% -79 - C3 -2RKN DIRL1_ARATH A:[1-77] --------------------------------------------------------------AIDLCGMS--Q--D--EL---NECKPAV--S-KEN--PTSP-----SQPCCTALQHA----------DF-ACLCGYKN---S------P-W------------LG-----SFG-------VDPELA-SALPKQCGL-A-NAP------TC-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
3 HHSearch 83.5633% -94 - C3 -2RKN DIRL1_ARATH A:[9-77] ------------------------------------------------------------------------Q--D--EL---NECKPAV--S-KENPTS--P-----SQPCCTALQH-----------ADFACLCGYKN---S------P-W------------LG-----SFG-------VDPELA-SALPKQCGL-A-NAP------TC-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
9 HHSearch 79.4639% -76 - C3 -1T12 - NLTP1_TOBAC A:[3-78] -----------------------------------------------------------------TC--G--Q--VTSNL---APCLAYL--R-NTG-----P-----LGRCCGGVKALVNSARTTEDRQI-ACTC--LK---S------A-A-------------G-----AISG------INLGKA-AGLPSTCGV-N-IP----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
26 SP3 75.3825% -58 * C3 *1FK5 NLTP_MAIZE A:[1-93] ---------------------------------------------------------------AISC--GQVA--S--AI---APCISYA--R-GQG--SG-P-----SAGCCSGVRS-----------LN-NA----AR---T------T-ADRRAACNCLKNAAA-----GVSG------LNAGNA-ASIPSKCGV-S-IPYTISTSTDCSRVN---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
8 HHSearch 74.6732% -66 - C3 -1AFH - NLTP_MAIZE A:[2-80] ----------------------------------------------------------------ISC--G--Q--VASAI---APCISYA--R-GQG--SG-P-----SAGCCSGVRSLNNAARTTADRRA-ACNC--LK---N------A-A-------------A-----GVSG------LNAGNA-ASIPSKCGV-S-IP----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
6 HHSearch 73.4130% -70 - C3 -2ALG NLTP1_PRUPE A:[2-79] ----------------------------------------------------------------ITC--G--Q--VSSSL---APCIPYV--R-GGG--A--V-----PPACCNGIRNVNNLARTTPDRQA-ACNC--LK---Q------L-S-------------A-----SVPG------VNPNNA-AALPGKCGV-S-IP----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
5 HHSearch 70.9523% -48 - C3 -1SIY - NLTP1_VIGRR A:[1-78] ----------------------------------------------------------------MTC--G--QVQG--NL---AQCIGFL--Q-KGG--V--V-----PPSCCTGVKNILNSSRTTADRRA-VCSCLKAA---A------G-A------------VR------G--------INPNNA-EALPGKCGV-N-IP----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
10 HHSearch 70.6529%-115 - C3 -1HYP - HPSE_SOYBN A:[10-73] ------------------------------------------------------------------------------DL---SICLNILGGS-LGT-----------VDDCCALIGGLGDIE------AI-VCLCIQLR---A---------------------LG-----I---------LNLNRNLQLILNSCGR-S-YP-------S--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
4 HHSearch 69.2028% -47 - C3 -1BWO NLTP1_WHEAT A:[8-78] ---------------------------------------------------------------------------S--LV---RPCLSYV--Q-GGP--G--P-----SGQCCDGVKNLHNQARSQSDRQS-ACNCLKGI---A------R-G------------IH------N--------LNEDNA-RSIPPKCGV-N-LP----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
27 SP3 53.7913% -85 - C3 -1U78 - TC3A_CAEEL A:[2-104] -------------------------------------------------------------PRGSAL--S--D--T--ER---AQ-LDVM--K-LLN--V--S-----LHEMSRKISR-----------SR-HCIRVYLK---D------PVS------------YG-----TSKRAPRRKALSVRDE-RNVIRAASN-S-CK-------TARDIRNELQLSASKRTILNVIKRSG-------------------------------------------------------------------------------------------------------------------------------------------------------------------------
31 SP3 51.8814% -62 - C3 -1KNG - CYCY_BRADU A:[50-193] ---------------------------------------------------RPAPQTALPPLEGLQA--D--N--V--QV---PGLDPAA--F-KG---K--VSLVNVWASWCVPCHD-----------EA-PLLTELGK---D------K-R------------FQLVGINYK--------DAADNA-RRFLGRYGN-P-FG-------RVGVDANGRASIEWGVYGVPETFVVGREGTIVYKLVGPITPDNLRSVLLPQMEKAL-------------------------------------------------------------------------------------------------------------------------------------------
29 SP3 49.4013% -66 - C3 -1F9M - TRXF_SPIOL A:[10-121] --------------------------------------------------------MEAIVGKVTEV--N--K--D--TF------WPIV--KAAGD--K--PVVLDMFTQWCGPCKA-----------MA-PKYEKLAE---EY-----L-DVI----------FL-----KL--------DCNQEN-KTLAKELGI-RVVP-------TFKILKENSVVGEVTGAKYDKLLEAIQAARS--------------------------------------------------------------------------------------------------------------------------------------------------------------------
19 Fugue 49.0313% -69 - C3 -1S6D - 2SS8_HELAN A:[1-103] --------------------------------------PYGRGRTESGCYQQMEEAEMLNHCGMYLM--K--N--L--GE---RSQVSPR--M-REE--D--H-----KQLCCMQLKNL----------DE-KCMCPAIM---MMLNEPMW-I------------RM-----RD--------QVMSMA-HNLPIECNL-M-SQ-------PCQM-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
34 SP3 45.9011% -60 - C3 -1PS6 PDXA_ECOLI A:[1-328] VKTQRVVITPGEPAGIGPDLVVQLAQREWPVELVVCADATLLTNRAAMLGLPLTLRPYSPNSPAQPQ--T--A--G--TLTLLPVALRAP--V-TAG--Q--L-----AVENGHYVVE-----------TL-ARACDGCL---N------G-E------------FA-----AL--------ITGPVH-KGVINDAGI-P-FT-------GHTEFFEERSQAKKVVMMLATEELRVALATTHLPLRDIADAITPALLHEVIAILHHDLRTKFGIAEPRILVCGLNPHAGEGGHMGTEEIDTIIPVLNELRAQGMKLNGPLPADTLFQPKYLDNADAVLAMYHDQGLPVLKYQGFGRGVNITLGLPFIRTSVDHGTALELAGRGKADVGSFITALNLAIKMIVNTQ
30 SP3 43.4616% -46 - C3 -1XFL - TRXH1_ARATH A:[1-114] -------------------------------------------------------MASEEGQVIACH--T--V--E--TW---NEQLQKA--N-ESK--T--LVVVDFTASWCGPCRF-----------IA-PFFADLAK---KL-----P-N------------VL-----FLK-------VDTDEL-KSVASDWAIQA-MP-------TFMFLKEGKILDKVVGAKKDELQSTIAKHLA--------------------------------------------------------------------------------------------------------------------------------------------------------------------
18 Fugue 42.9238% -62 - C3 -3S1B - ? A:[1-34] ---------------------------------------------------------------------------------------------------------------------F-----------NK-ECLLRYKEAALD------P-N------------LN-----LY--------QRIAKI-VSIDDDC-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------


User Run . : Multi Template Modeling Result:

(3 SA) .........10........20........30........40........50........60.......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) VTCSPQELSPCFAAFSSSAPPSSTCCSKLKEQKPCLCGYLKDPNFSQYVNSAKAKKIASTCGVQFPSC
40 94.18100%-112 - C- -M040 - A:[1-101] VTCSPQELSPCFAAFSSSAPPSSTCCSKLKEQKPCLCGYLKDPNFSQYVNSAKAKKIASTCGVQFPSC
41 92.44100%-106 - C- -M041 - A:[1-101] VTCSPQELSPCFAAFSSSAPPSSTCCSKLKEQKPCLCGYLKDPNFSQYVNSAKAKKIASTCGVQFPSC
39 88.87100% -88 - C- -M039 - A:[1-101] VTCSPQELSPCFAAFSSSAPPSSTCCSKLKEQKPCLCGYLKDPNFSQYVNSAKAKKIASTCGVQFPSC