@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : 763_tI_VITVI: (2014-05-14 )
EPSCPRVIREVAPCLSFFQDDGPAKPSKRCCEGVTEVNGMAKTKKDRVAICECLKQTLNYIDYDPKRIPLLGKQCGLTIDLPPTGQNTNCSQVAY

Atome Classification :

(20 SA) -----------------------------------------------------------------------------------.....--....10--.........20--------------------..-----....-----------..30........40........50...--.-..-..60-------..----.-----.-----------....70.--------------------.......80.-.......-90....-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) -----------------------------------------------------------------------------------EPSCP--RVIRE---VAPCLSFFQDD--------------------GP-----AKPS-----------KRCCEGVTEVNGMAKTKKDRVAICECL--K-QT-LNYI-------DY----D-----P-----------KRIPLLG--------------------KQCGLTIDLP-PTGQNTN-CSQVAY-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
19 HHSearch 90.8533%-105 - C2 -1T12 - NLTP1_TOBAC A:[1-91] -----------------------------------------------------------------------------------AITCG--QVTSN---LAPCLAYLRNT--------------------G--------PL-----------GRCCGGVKALVNSARTTEDRQIACTCL--K-SA-AGAIS------GI----N-----L-----------GKAAGLP--------------------STCGVNIPYK--ISPSTD-CSKVQ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
11 SP3 88.8932% -92 - C2 -1FK5 NLTP_MAIZE A:[1-93] -----------------------------------------------------------------------------------AISCG--QVASA---IAPCISYARGQ--------------------GS-----G-PS-----------AGCCSGVRSLNNAARTTADRRAACNCL--K-NA-AAGVS------GL----N-----A-----------GNAASIP--------------------SKCGVSIPY--TISTSTD-CSRVN------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
18 HHSearch 86.3534% -85 - C2 -1AFH - NLTP_MAIZE A:[1-93] -----------------------------------------------------------------------------------AISCG--QVASA---IAPCISYARGQ--------------------GS------GPS-----------AGCCSGVRSLNNAARTTADRRAACNCL--K-NA-AAGVS------GL----N-----A-----------GNAASIP--------------------SKCGVSIPYT--ISTSTD-CSRVN------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
22 HHSearch 84.2730%-100 - C2 -1SIY - NLTP1_VIGRR A:[1-91] ------------------------------------------------------------------------------------MTCG--QVQGN---LAQCIGFLQKG--------------------G-------VVP-----------PSCCTGVKNILNSSRTTADRRAVCSCL--K-AA-AGAVR------GI----N-----P-----------NNAEALP--------------------GKCGVNIPYK--ISTSTN-CNSIN------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
1 Fugue 84.1834% -89 - C2 -1BWO NLTP1_WHEAT A:[1-90] ------------------------------------------------------------------------------------IDCG--HVDSL---VRPCLSYVQGG--------------------P-------GPS-----------GQCCDGVKNLHNQARSQSDRQSACNCL--K-GI-ARGI-------HNLN--------E-----------DNARSIP--------------------PKCG--VNLPYTISLNID-CSRV-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
21 HHSearch 83.2831% -82 - C2 -1BWO NLTP1_WHEAT A:[1-90] ------------------------------------------------------------------------------------IDCG--HVDSL---VRPCLSYVQGG---------------------------PGPS-----------GQCCDGVKNLHNQARSQSDRQSACNCL--K-GI-ARGIH------NL----N-----E-----------DNARSIP--------------------PKCGVNLPYT--ISLNID-CSRV-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
20 HHSearch 82.6733% -99 - C2 -2ALG NLTP1_PRUPE A:[1-92] -----------------------------------------------------------------------------------MITCG--QVSSS---LAPCIPYVRGG--------------------G-------AVP-----------PACCNGIRNVNNLARTTPDRQAACNCL--K-QL-SASVP------GV----N-----P-----------NNAAALP--------------------GKCGVSIPYK--ISASTN-CATVK------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
6 Fugue 67.8818%-120 - C2 -1HSS - IAA1_WHEAT A:[5-124] -------------------------------------------------------------------------------------MCYPGQAFQVPA-LPACRPLLRLQCNGSQV--------------P------EAVL-----------RDCCQQLAHI--------SEWCRCGAL--Y-SM-LDS---------M----Y-----K-----------EH-----GAFPRCRREVVKLTAASITA-VCRLPIVVD-ASGDGAYVCKDVAAYPDA-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
2 Fugue 61.4326% -88 - C2 -2RKN DIRL1_ARATH A:[1-77] ----------------------------------------------------------------------------------AIDLCG--MSQDE---LNECKPAVSKE--------------------NP-----TSPS-----------QPCCTALQHA--------DFACLCGYK--NSPW-LGSF-------GV----D-----P-----------ELASALP--------------------KQCGLA--------NAPT-C----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
10 Fugue 58.6517%-129 - C2 -1S6D - 2SS8_HELAN A:[1-103] ----------------------------------------------------------------------------PYGRGRTESGCY--QQMEEAEMLNHCGMYLMKN--------------------LG-----ERSQVSPRMREEDHKQLCCMQLKNLDEKCM--------CPAI--M-MM-LNEP-------MW----I-----RMRDQVM-----SMAHNLP--------------------IECNLM---------SQP-CQM--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
23 HHSearch 58.3227% -87 - C2 -2RKN DIRL1_ARATH A:[3-74] ------------------------------------------------------------------------------------DLCG--MSQDE---LNECKPAVSKE--------------------NP-----TSPS-----------QPCCTALQHA--------DFACLCGYK--N-SPWLGSF-------GV----D-----P-----------ELASALP--------------------KQCGLANA----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
27 HHSearch 56.3228%-102 - C2 -3OB4 - ? A:[429-485] -------------------------------------------------------------------------------------------------------------------------------------------------------ERCCNELNEFE------NNQRCMCEAL--Q-QI-MENQSDRLQ--GR----QQEQQFK-----------RELRNLP--------------------QQCGLRAP----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
4 Fugue 53.6617% -85 - C2 -1PSY - 2SS_RICCO A:[1-125] ---------------------------------------------------------------------AEFMESKGEREGSSSQQCR--QEVQRKD-LSSCERYLRQSSSRRSTGEEVLRMPGDENQQQE-----SQQL-----------QQCCNQVKQVRDE--------CQCEAI--K-YI-AEDQ-------IQ----Q-----GQLHGEESERVAQRAGEIV--------------------SSCGVR---C-MRQTRTN------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
29 HHSearch 37.6421% -97 - C2 -1PNB - ? B:[12-65] -------------------------------------------------------------------------------------------------------------------------------------------------------EQCCNELYQED--------QVCVCPTL--K-QA-AKSVRVQGQHGPFQSTRI-----Y-----------QIAKNLP--------------------NVCNMK------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
24 HHSearch 35.4723% -37 - C2 -1N89 NLT2G_WHEAT A:[4-65] --------------------------------------------------------------------------------------------ASQ---LAVCASAILSG--------------------A-------KPS-----------GECCGNLRA-----------QQGCFCQYAK-DP-TYGQ-------YI----R-----S-----------PHARDTL--------------------TSCGLAVP----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
12 SP3 34.7211% -46 * C3 *1EHX - ? A:[1-94] ---------------------------------------------------------------------------------MQDPTIN--PTS---------ISAKAGS--------------------FADTKITLTPN-----------GNTFNGISELQSSQYTKG----------------TNEV-------TL----L-----A-----------SYLNTLP--------------------ENTTKTLTFD-FGVGTKN--PKLTITVLPKDIPGLE------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
5 Fugue 33.6817% -31 - C2 -1L6H - NLTPX_ORYSJ A:[1-69] ------------------------------------------------------------------------------------AGCN--A--GQ---LTVCTGAIA----------------------GG-----ARPT-----------AACCS---------SLRAQQGCFCQFA--K-DP-RYGR-------YV----N-----S-----------PNARKAV--------------------SSCGI---------ALPT-CH---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
8 Fugue 31.2315% -18 - C2 -4C3X ? A:[23-530] DWTSECDVLVVGSGGGALTGAYTAAAQGLTTIVLEKTDRFGGTSAYSGASIWLPGTQVQERAGLPDSTENARTYLRALLGDAESERQD--AYVET---APAVVALLEQN--------------------PN-----IEFE-----------FRAFPDYYKAEGRMDTGR--------------S-INPL-------DL----D-----P-----------ADIGDLA--------------------GKVRPELDQD-RTGQDHA-PGPMIGGRALIGRLLAAVQSTGKAELRTESVLTSLIVEDGRVVGAEVESGGETQRIKANRGVLMAAGGIEGNAEMREQAGTPGKAIWSMGPFGANTGDAISAGIAVGGATALLDQAWFCPGVEQPDGSAAFMVGVRGGLVVDSAGERYLNESLPYDQFGRAMDAHDDNGSAVPSFMIFDSREGGGLPAICIPNTAPAKHLEAGTWVGADTLEELAAKTGLPADALRSTVEKFNDAAKLGVDEEFHRGEDPYDAFFCPPNGGANAALTAIENGPFYAARIVLSDLGTKGGLVTDVNGRVLRADGSAIDGLYAAGNTSASLSGRFYPGPGVPLGTAMVFSYRAAQDMAK
25 HHSearch 31.0316% -50 - C2 -1L6H - NLTPX_ORYSJ A:[6-66] ---------------------------------------------------------------------------------------------GQ---LTVCTGAIAGG--------------------A-------RPT-----------AACCSSLRA-----------QQGCFCQFAK-DPRYGR--------YV----N-----S-----------PNARKAV--------------------SSCGIALP----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
30 HHSearch 22.6522% -62 - C2 -1P7O - PA2A2_TROCA A:[89-114] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------DKCKLFICNCD--R-TA-AMCFAKA----PY----N-----E-----------A--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------


User Run . : Multi Template Modeling Result:

(3 SA) .........10........20........30........40........50........60........70........80........90....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) EPSCPRVIREVAPCLSFFQDDGPAKPSKRCCEGVTEVNGMAKTKKDRVAICECLKQTLNYIDYDPKRIPLLGKQCGLTIDLPPTGQNTNCSQVAY
38 92.27100%-125 - C- -M038 - A:[1-99] EPSCPRVIREVAPCLSFFQDDGPAKPSKRCCEGVTEVNGMAKTKKDRVAICECLKQTLNYIDYDPKRIPLLGKQCGLTIDLPPTGQNTNCSQVAY
32 88.32100%-114 - C- -M032 - A:[1-99] EPSCPRVIREVAPCLSFFQDDGPAKPSKRCCEGVTEVNGMAKTKKDRVAICECLKQTLNYIDYDPKRIPLLGKQCGLTIDLPPTGQNTNCSQVAY
31 87.64100%-109 - C- -M031 - A:[1-99] EPSCPRVIREVAPCLSFFQDDGPAKPSKRCCEGVTEVNGMAKTKKDRVAICECLKQTLNYIDYDPKRIPLLGKQCGLTIDLPPTGQNTNCSQVAY