@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : X_NR1C1_PPARA: (2016-04-07 )
MSTIMVDTNSELCILTPLDEDDLESPLSGEFLQDIVDIQDITQTIGDDGSTPFGASEHQFFGNSPGSIGSVSTDLTDTLSPASSPASITFPAASGSAEDAACKSLNLECRVCSDKASGFHYGVHACEGCKGFFRRTIRLKLVYDRCERMCKIQKKNRNKCQYCRFEKCLNVGMSHNAIRFGRMPRSEKAKLKAEVLMCDQDVKDSQMADLLSLARLIYDAYLKNFNMNKVKARAILTGKASNPPFVIHDMETLCMAEKTLVAKLVANGIQNKEAEVRIFHCCQCTSVETVTELTEFAKSIPGFTELDLNDQVTLLKYGVYEAMFAMLASVMNKDGMLVAYGNGFITREFLKSLRKPIGDMMEPKFEFAMKFNALELDDSDLSLFVAALICCGDRPGLVNIPSIEKMQESIVHVLKLHLQSNHPDDSFLFPKLLQKMADLRQLVTEHAQLVQTIKKTETDAALHPLLQEIYRDMY

Atome Classification :

(205 SA) .........10........20........30........40........50........60........70........80........90........100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240-.......250.......260.....-..270........280.......290.......300.......310.......320.......330.......340.......350.......360.......370.......380.......390.......400.......410.......420.......430.......440.......450.......460.......470..
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MSTIMVDTNSELCILTPLDEDDLESPLSGEFLQDIVDIQDITQTIGDDGSTPFGASEHQFFGNSPGSIGSVSTDLTDTLSPASSPASITFPAASGSAEDAACKSLNLECRVCSDKASGFHYGVHACEGCKGFFRRTIRLKLVYDRCERMCKIQKKNRNKCQYCRFEKCLNVGMSHNAIRFGRMPRSEKAKLKAEVLMCDQDVKDSQMADLLSLARLIYDAYLKNFNMNKVKARAILTGKASN-PPFVIHDMETLCMAEKTLVAKLVAN-GIQ-NKEAEVRIFHCCQCTSVETVTELTEFAKSIPGFTELDLNDQVTLLKYGVYEAMFAMLASVMNKDGMLVAYGNGFITREFLKSLRKPIGDMMEPKFEFAMKFNALELDDSDLSLFVAALICCGDRPGLVNIPSIEKMQESIVHVLKLHLQSNHPDDSFLFPKLLQKMADLRQLVTEHAQLVQTIKKTETDAALHPLLQEIYRDMY
5 PsiBlast_PDB 89.8188%-153 - C5 -4CI4 PPARA_HUMAN A:[10-273] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------KSLAKRIYEAYLKNFNMNKVKARVILS------PPFVIHDMETLCMAEKTLV------------KEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDM-
14 PsiBlast_PDB 88.8889%-142 - C5 -2P54 PPARA_HUMAN A:[1-267] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVAN-GIQ-NKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
2 PsiBlast_PDB 88.8462%-124 - C5 -3E00 PPARG_HUMAN D:[49-419] --------------------------------------------------------------------------------------------------------MAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEI-SSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKF--------Q-SKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
30 PsiBlast_CBE 88.7789%-139 - C5 -3ET1 PPARA_HUMAN B:[22-291] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVAN-GIQ-NKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
31 PsiBlast_CBE 88.4588%-144 - C5 -2NPA PPARA_HUMAN C:[199-468] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ETADLKSLAKRIYEAYLKNFNMNKVKARVILSGAASNNPPFVIHDMETLCMAEKTLVAKLV----IQ-NKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
8 PsiBlast_PDB 88.1189%-140 - C5 -3SP6 PPARA_HUMAN A:[13-285] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------EDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVAN-----NKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
15 PsiBlast_PDB 87.5289%-146 - C5 -3FEI PPARA_HUMAN A:[1-267] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DLKSLAKRIYEAYLKNFNMNKVKARVILS-------PFVIHDMETLCMAEK----------------EAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
13 PsiBlast_PDB 87.2389%-138 - C5 -3ET1 PPARA_HUMAN A:[22-291] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVA--------Q-NKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
1 PsiBlast_PDB 87.0162%-128 - C5 -3DZU PPARG_HUMAN D:[50-419] ---------------------------------------------------------------------------------------------------------AIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEI-SSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKF------------EVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
16 PsiBlast_PDB 86.9388%-138 - C5 -2NPA PPARA_HUMAN A:[199-467] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ETADLKSLAKRIYEAYLKNFNMNKVKARVILSGAASNNPPFVIHDMETLCMAEKTLVAKLVAN-GIQ-NKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDM-
24 PsiBlast_CBE 86.7888%-143 - C5 -4BCR PPARA_HUMAN B:[2-273] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------EDSETADLKSLAKRIYEAYLKNFNMNKVKARVILS-------PFVIHDMETLCMAEKTLVAKLVAN-GIQ-NKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDM-
4 PsiBlast_PDB 86.2988%-141 - C5 -4BCR PPARA_HUMAN A:[10-272] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------KSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVAN-GIQ-NKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRD--
9 PsiBlast_PDB 86.0789%-145 - C5 -3G8I PPARA_HUMAN A:[4-270] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DLKSLAKRIYEAYLKNFNMNKVKARVILS------PPFVIHDMETLCMAEKTLVAKL---------KEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
11 PsiBlast_PDB 85.6089%-138 - C5 -2ZNN PPARA_HUMAN A:[7-273] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DLKSLAKRIYEAYLKNFNMNKVKARVILS-------PFVIHDMETLCMAEKTLVAKLVAN-G---NKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
247 HHSearch 85.1589%-138 - C5 -3VI8 PPARA_HUMAN A:[7-273] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DLKSLAKRIYEAYLKNFNMNKVKARVILS-------PFVIHDMETLCMAEKTLVAKLVAN-G---NKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
12 PsiBlast_PDB 85.1589%-138 - C5 -3VI8 PPARA_HUMAN A:[7-273] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DLKSLAKRIYEAYLKNFNMNKVKARVILS-------PFVIHDMETLCMAEKTLVAKLVAN-G---NKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
36 PsiBlast_CBE 82.9770%-147 - C5 -3PEQ PPARD_HUMAN B:[3-271] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ADLKAFSKHIYNAYLKNFNMTKKKARSILT------APFVIHDIETLWQAEKGLVW-------LPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY
46 PsiBlast_CBE 82.7970%-143 - C5 -3TKM PPARD_HUMAN A:[5-275] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QVADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVW------GLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY
34 PsiBlast_CBE 82.6269%-142 - C5 -2XYJ PPARD_HUMAN B:[20-287] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ADLKAFSKHIYNAYLKNFNMTKKKARSILTG----TAPFVIHDIETLWQAEKGLVW------GLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDM-
52 PsiBlast_CBE 82.6170%-141 - C5 -2ZNQ PPARD_HUMAN B:[6-274] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QVADLKAFSKHIYNAYLKNFNMTKKKARSILTG-----APFVIHDIETLWQAEKGLVW-------LPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKD--
57 PsiBlast_CBE 82.2370%-140 - C5 -3SP9 PPARD_HUMAN A:[13-281] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVN-GLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY
45 PsiBlast_CBE 82.2170%-140 - C5 -1Y0S PPARD_HUMAN A:[2-270] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QVADLKAFSKHIYNAYLKNFNMTKKKARSILTG-----APFVIHDIETLWQAEKGLVW------GLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKD--
41 PsiBlast_CBE 81.9970%-146 - C5 -3DY6 PPARD_HUMAN A:[2-269] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------VADLKAFSKHIYNAYLKNFNMTKKKARSILT------APFVIHDIETLWQAEKGLVW------GLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKD--
58 PsiBlast_CBE 81.9069%-141 - C5 -2B50 PPARD_HUMAN B:[1-271] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------NPQVADLKAFSKHIYNAYLKNFNMTKKKARSILTG---HTAPFVIHDIETLWQAEKGLVWK------LPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQQLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKD--
27 PsiBlast_CBE 81.9089%-132 - C5 -1KKQ PPARA_HUMAN D:[2-269] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVAN-GIQ-NKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
40 PsiBlast_CBE 81.8270%-144 - C5 -3DY6 PPARD_HUMAN B:[4-269] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DLKAFSKHIYNAYLKNFNMTKKKARSILT------APFVIHDIETLWQAEKGLVW------GLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKD--
56 PsiBlast_CBE 81.7670%-139 - C5 -3SP9 PPARD_HUMAN B:[13-281] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ADLKAFSKHIYNAYLKNFNMTKKKARSILTGK--HTAPFVIHDIETLWQAEKGLVWKQLVN-GLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY
37 PsiBlast_CBE 81.7370%-143 - C5 -3PEQ PPARD_HUMAN A:[3-269] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ADLKAFSKHIYNAYLKNFNMTKKKARSILT------APFVIHDIETLWQAEKGLVW-------LPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKD--
55 PsiBlast_CBE 81.6770%-141 - C5 -2ZNP PPARD_HUMAN A:[10-275] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLV--------LPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDM-
20 PsiBlast_PDB 81.6669%-143 - C5 -3ET2 PPARD_HUMAN A:[18-286] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------VADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVW---VN-GLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDM-
54 PsiBlast_CBE 81.5570%-140 - C5 -2ZNP PPARD_HUMAN B:[6-274] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QVADLKAFSKHIYNAYLKNFNMTKKKARSILTG---HTAPFVIHDIETLWQAEKGLVW-------LPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKD--
35 PsiBlast_CBE 81.5569%-141 - C5 -3ET2 PPARD_HUMAN B:[19-287] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ADLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWK--VN-GLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY
60 PsiBlast_CBE 81.4870%-148 - C5 -2AWH PPARD_HUMAN B:[1-267] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DLKAFSKHIYNAYLKNFNMTKKKARSILT------APFVIHDIETLWQAEKGLVW------------EISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQQLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDM-
65 PsiBlast_CBE 81.2870%-145 - C5 -2BAW PPARD_HUMAN B:[1-267] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LKAFSKHIYNAYLKNFNMTKKKARSILT-------PFVIHDIETLWQAEKGL-------------KEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQQLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY
53 PsiBlast_CBE 81.2370%-139 - C5 -2ZNQ PPARD_HUMAN A:[9-276] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DLKAFSKHIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVW-------LPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDMY
18 PsiBlast_PDB 81.2369%-143 - C5 -2XYW PPARD_HUMAN A:[21-287] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DLKAFSKHIYNAYLKNFNMTKKKARSILTGKA----PFVIHDIETLWQAEKGLVWKQLVN-GLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDM-
44 PsiBlast_CBE 81.1570%-140 - C5 -1Y0S PPARD_HUMAN B:[4-271] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ADLKAFSKHIYNAYLKNFNMTKKKARSILTG-----APFVIHDIETLWQAEKGLVW------GLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDM-
32 PsiBlast_CBE 81.1569%-139 - C5 -2XYX PPARD_HUMAN B:[21-287] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DLKAFSKHIYNAYLKNFNMTKKKARSILTGKA----PFVIHDIETLWQAEKGLVWKQLVN-GLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDM-
28 PsiBlast_CBE 81.1489%-135 - C5 -1KKQ PPARA_HUMAN C:[2-269] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPPFVIHDMETLCMAEKTLVAKLVAN-GIQ-NKEAEVRIFHCCQCTSVETVTELTEFAKAIPGFANLDLNDQVTLLKYGVYEAIFAMLSSVMNKDGMLVAYGNGFITREFLKSLRKPFCDIMEPKFDFAMKFNALELDDSDISLFVAAIICCGDRPGLLNVGHIEKMQEGIVHVLRLHLQSNHPDDIFLFPKLLQKMADLRQLVTEHAQLVQIIKKTESDAALHPLLQEIYRDMY
49 PsiBlast_CBE 81.0369%-142 - C5 -3OZ0 PPARD_HUMAN A:[19-284] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LKAFSKHIYNAYLKNFNMTKKKARSILT------APFVIHDIETLWQAEKGLVWKQLVN-GLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDM-
19 PsiBlast_PDB 81.0169%-142 - C5 -2XYX PPARD_HUMAN A:[23-287] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------KAFSKHIYNAYLKNFNMTKKKARSILTGKA----PFVIHDIETLWQAEKGLVWKQLVN-GLPPYKEISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNKDGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGDRPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRIKKTETETSLHPLLQEIYKDM-