@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : X_NR1C3_PPARG: (2016-04-07 )
MVDTEMPFWSNLNFGMNSMDMSALEDHCQPYDIKPFTTVDFSSINSHYDDILDEKTFLCRNDQSPIDYKYDLKLQECQSSIKLEPPSPPYFSDKPQCSKAFEDTPNSFIAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYERCDLNCRIHKKSRNKCQFCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADQRVLAKHLYDSYVKSFPLTKAKAPGHPDGQSHRQNSRGYTRHELADDGGGSDQGAVREPRAEQGGGDSNLPALSVALRGGVREITEFAKNIPGFVSLDLNDQVTLLKYGVHEIIFTMLASLMNKDGVLVAEGQGFMTREFLKSLRKPFSDFMEPKFEFAIRFNSLELDDSDLAIFVAVIILSGDRPGLLNVKPIEDIQDSLLQALELQLKLNHPDSAQLFAKLLQKMTDLRQVVTEHVQLLQLIKKTEADMCLHPLLQEIYKDLY

Atome Classification :

(187 SA) .........10........20........30........40........50........60........70........80........90........100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250...--------------....260.......270.........280.....---..290--------.--........300.......310.......320.......330.......340.......350.......360.......370.......380.......390.......400.......410.......420.......430.......440.......450.......460.......470.....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MVDTEMPFWSNLNFGMNSMDMSALEDHCQPYDIKPFTTVDFSSINSHYDDILDEKTFLCRNDQSPIDYKYDLKLQECQSSIKLEPPSPPYFSDKPQCSKAFEDTPNSFIAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYERCDLNCRIHKKSRNKCQFCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADQRVLAKHLYDSYVKSFPLTKAKAPGHPDGQSHRQNSRGYTRHE--------------LADDGGGSDQGAVRE--PRAEQGGGDSNLPALSV---ALR----------G--GVREITEFAKNIPGFVSLDLNDQVTLLKYGVHEIIFTMLASLMNKDGVLVAEGQGFMTREFLKSLRKPFSDFMEPKFEFAIRFNSLELDDSDLAIFVAVIILSGDRPGLLNVKPIEDIQDSLLQALELQLKLNHPDSAQLFAKLLQKMTDLRQVVTEHVQLLQLIKKTEADMCLHPLLQEIYKDLY
2 PsiBlast_PDB 88.1476%-109 - C5 -3E00 PPARG_HUMAN D:[49-419] ------------------------------------------------------------------------------------------------------------MAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDKIKF--------QSKEVAIRIFQGC---QFR----------SVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
1 PsiBlast_PDB 87.2676%-109 - C5 -3DZU PPARG_HUMAN D:[50-419] -------------------------------------------------------------------------------------------------------------AIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNCRIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDKIKF-----------EVAIRIFQGC---QFR----------SVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
38 PsiBlast_CBE 80.3871%-112 - C5 -3VJH PPARG_HUMAN A:[13-286] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDK-------------K--------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDL-
45 PsiBlast_CBE 79.5271%-107 - C5 -3AN4 PPARG_HUMAN A:[15-286] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------NPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDKIK----------SK--------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDL-
157 PsiBlast_CBE 79.3870%-110 - C5 -2GTK PPARG_HUMAN A:[1-271] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDK-------------K--------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
152 PsiBlast_CBE 79.3770%-113 - C5 -3FEJ PPARG_HUMAN A:[1-271] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDK-------------K--------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
11 PsiBlast_PDB 79.3171%-110 - C5 -4A4V PPARG_HUMAN A:[13-287] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDKI-----------SK--------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
111 PsiBlast_CBE 79.2871%-113 - C5 -2Q5S PPARG_HUMAN A:[5-274] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGED--------------K--------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
133 PsiBlast_CBE 79.2170%-109 - C5 -3V9Y PPARG_HUMAN A:[13-283] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDKIKFK------------------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
19 PsiBlast_PDB 78.9571%-107 - C5 -3PBA PPARG_HUMAN A:[13-285] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDKI-----------SK--------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDL-
134 PsiBlast_CBE 78.8570%-111 - C5 -3V9V PPARG_HUMAN A:[13-283] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDKI---------------------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
64 PsiBlast_CBE 78.7871%-112 - C5 -3OSW PPARG_HUMAN A:[14-285] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------NPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDKI-----------SK--------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDL-
169 PsiBlast_CBE 78.6770%-107 - C5 -3ET3 PPARG_HUMAN A:[22-292] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDKIK--------------------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
88 PsiBlast_CBE 78.6371%-110 - C5 -2VST PPARG_HUMAN A:[3-274] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDKIK--------------------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKD--
112 PsiBlast_CBE 78.5271%-109 - C5 -2Q5P PPARG_HUMAN A:[4-273] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGED--------------K--------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDL-
65 PsiBlast_CBE 78.4371%-111 - C5 -3OSI PPARG_HUMAN A:[14-285] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------NPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDKIK--------------------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDL-
37 PsiBlast_CBE 78.4071%-107 - C5 -3VSO PPARG_HUMAN A:[15-286] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------NPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDKIKF---------SK--------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDL-
100 PsiBlast_CBE 78.3271%-107 - C5 -2XKW PPARG_HUMAN A:[1-274] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDK-------------K--------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
181 PsiBlast_CBE 78.2870%-110 - C5 -3U9Q PPARG_HUMAN A:[208-476] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDKIK--------------------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDL-
84 PsiBlast_CBE 78.1271%-108 - C5 -2VV1 PPARG_HUMAN A:[5-274] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PESADLRALAKHLYDSYIKSFPLTKAKARAILTG-T--TDKSPFVIYD--------------MNSLMMGEDKI---------------------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKD--
59 PsiBlast_CBE 78.1071%-106 - C5 -2ZK1 PPARG_HUMAN A:[13-286] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDKIKFKHITPLQEQSK--------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDL-
162 PsiBlast_CBE 78.0970%-106 - C5 -2F4B PPARG_HUMAN A:[1-271] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDKIKFKHITPLQEQSK--------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
6 PsiBlast_PDB 78.0871%-110 - C5 -3ADV PPARG_HUMAN A:[13-286] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDKIK--------------------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDL-
96 PsiBlast_CBE 78.0471%-115 - C5 -2OM9 PPARG_HUMAN B:[8-277] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ESADLRALAKHLYDSYIKSFPLTKAKARAILT-------KSPFVIYD--------------MNSLMMGEDKIKFKHITP-----K--------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDL-
180 PsiBlast_CBE 78.0270%-111 - C5 -4Y29 ? A:[1-269] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDKIK--------------------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDL-
60 PsiBlast_CBE 78.0171%-107 - C5 -2I4Z PPARG_HUMAN A:[17-286] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDKIKFKHITPLQEQSK--------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDL-
151 PsiBlast_CBE 77.9970%-112 - C5 -3G9E PPARG_HUMAN A:[1-271] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDK-------------K--------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
90 PsiBlast_CBE 77.9971%-109 - C5 -2VSR PPARG_HUMAN A:[6-274] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDKIK--------------------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKD--
86 PsiBlast_CBE 77.9971%-111 - C5 -2VV0 PPARG_HUMAN A:[3-274] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGED--------------K--------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKD--
155 PsiBlast_CBE 77.9770%-111 - C5 -2HWR PPARG_HUMAN A:[1-271] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDKIKFK------------------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
46 PsiBlast_CBE 77.9071%-107 - C5 -3AN3 PPARG_HUMAN A:[13-286] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDKI-----------SK--------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDL-
10 PsiBlast_PDB 77.8971%-109 - C5 -2YFE PPARG_HUMAN A:[12-286] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DQLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDKI-----------SK--------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDL-
135 PsiBlast_CBE 77.8770%-110 - C5 -3V9T PPARG_HUMAN A:[12-282] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDKI-----------SK--------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTET--SLHPLLQEIYKDL-
4 PsiBlast_PDB 77.8771%-111 - C5 -3ADT PPARG_HUMAN A:[13-286] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGED-----------------------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDL-
161 PsiBlast_CBE 77.8070%-112 - C5 -2FVJ PPARG_HUMAN A:[1-271] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDK-------------K--------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
94 PsiBlast_CBE 77.7571%-113 - C5 -2OM9 PPARG_HUMAN D:[8-277] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ESADLRALAKHLYDSYIKSFPLTKAKARAILT-------KSPFVIYD--------------MNSLMMGEDKIKFKHITP-----K--------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDL-
137 PsiBlast_CBE 77.6870%-110 - C5 -3B1M PPARG_HUMAN A:[12-283] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDKIK--------------------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
7 PsiBlast_PDB 77.6871%-106 - C5 -3ADW PPARG_HUMAN A:[13-286] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDKIKFKHITPLQEQSK--------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDL-
50 PsiBlast_CBE 77.6471%-106 - C5 -2ZK6 PPARG_HUMAN A:[13-286] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDKIKFKHITPLQEQSK--------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDL-
43 PsiBlast_CBE 77.6071%-109 - C5 -3CDP PPARG_HUMAN A:[17-286] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDKIKFKHITPLQEQSK--------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDL-
119 PsiBlast_CBE 77.5370%-110 - C5 -3KMG PPARG_HUMAN D:[3-271] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDK-------------K--------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDL-
118 PsiBlast_CBE 77.5370%-107 - C5 -4CI5 PPARG_HUMAN A:[1-272] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------PESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDKIK--------------------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
80 PsiBlast_CBE 77.5271%-113 - C5 -2VV4 PPARG_HUMAN A:[4-274] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------NPESADLRALAKHLYDSYIKSFPLTKAKARAILTG----TDKSPFVIYD--------------MNSLMMGED-----------------------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKD--
54 PsiBlast_CBE 77.4671%-103 - C5 -2ZK4 PPARG_HUMAN A:[13-286] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDKIKFKHITPLQEQSK--------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDL-
18 PsiBlast_PDB 77.4571%-105 - C5 -2ZVT PPARG_HUMAN A:[13-286] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDKIKFKHITPLQEQSK--------EV---AIRIFQGSQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDL-
62 PsiBlast_CBE 77.4371%-107 - C5 -2I4J PPARG_HUMAN A:[17-286] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDKIKFKHITPLQEQSK--------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDL-
5 PsiBlast_PDB 77.4371%-112 - C5 -3ADU PPARG_HUMAN A:[13-286] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGED-----------------------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDL-
69 PsiBlast_CBE 77.4271%-110 - C5 -1I7I PPARG_HUMAN A:[22-291] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDKIK--------------------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDL-
8 PsiBlast_PDB 77.3971%-105 - C5 -3ADX PPARG_HUMAN A:[13-286] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDKIKFKHITPLQEQSK--------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDL-
3 PsiBlast_PDB 77.3971%-108 - C5 -3ADS PPARG_HUMAN A:[13-286] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDKIK--------------------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDL-
79 PsiBlast_CBE 77.3671%-110 - C5 -3X1H PPARG_HUMAN A:[6-273] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDKIK--------------------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYK---
36 PsiBlast_CBE 77.3071%-106 - C5 -3VSP PPARG_HUMAN A:[13-286] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKT--TDKSPFVIYD--------------MNSLMMGEDKIKF---------SK--------EV---AIRIFQGCQFRSVE--AVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDL-