@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Z_NR3C3_PRGR: (2016-07-28 )
MLGGRKMKRFAGLKVMGLSPSLMFQSPLSLLTDGQTLSSLPCMSAMRELQLSPQMISILENIEPQVVYSGYDNTQPEVPHLLLNSLNRLCERQLLWIVRWSKSLPGFRNLHINDQMTLIQYSWMGLMLFSLGWRTFQNVTPDYLYFAPDLVLSNDQLRRSPIYDLCLAMQFVPQEFANLQVTKEEFLCMKALMLLNTVPLEGLKSQTQFDEMRQNYICELSKAIQLKEKGVVASSQRFYHLTKLMDNMHEIVKKVNLYCLSTFIQADAMKVEFPEMMTEVIASQLPKVLAGMVKPLMFHHK

Atome Classification :

(79 SA) .........10........20........30........40........50........60........70........80........90........100.......110.......120.......130.......140---.......150......-.160.......170.......180.......190......--.200.......210.......220.......230.......240.......250.......260.......270.......280.......290.......300
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MLGGRKMKRFAGLKVMGLSPSLMFQSPLSLLTDGQTLSSLPCMSAMRELQLSPQMISILENIEPQVVYSGYDNTQPEVPHLLLNSLNRLCERQLLWIVRWSKSLPGFRNLHINDQMTLIQYSWMGLMLFSLGWRTFQNVTPD---YLYFAPDLVLSNDQLR-RSPIYDLCLAMQFVPQEFANLQVTKEEFLCMKALMLLNTV--PLEGLKSQTQFDEMRQNYICELSKAIQLKEKGVVASSQRFYHLTKLMDNMHEIVKKVNLYCLSTFIQADAMKVEFPEMMTEVIASQLPKVLAGMVKPLMFHHK
28 PsiBlast_CBE 93.7165%-157 - C5 -3HQ5 B:[5-255] -------------------------------------------------QLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQ---MLYFAPDLILNEQRMK-ESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTI--PLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHK-
21 PsiBlast_CBE 93.3564%-156 - C5 -3G8O B:[13-262] --------------------------------------------------LIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQ---MLYFAPDLILNEQRMK-ESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTI--PLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHK-
3 PsiBlast_PDB 92.7865%-156 - C5 -3ZR7 PRGR_HUMAN A:[10-259] --------------------------------------------------LIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQ---MLYFAPDLILNEQRMK-ESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTI--PLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHK-
29 PsiBlast_CBE 92.6165%-151 - C5 -1A28 B:[6-254] --------------------------------------------------LIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQ---MLYFAPDLILNEQRMK-ESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTI--PLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFH--
12 PsiBlast_PDB 92.6064%-158 - C5 -1E3K PRGR_HUMAN A:[7-257] -------------------------------------------------QLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQ---MLYFAPDLILNEQRMK-ESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTI--PLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHK-
11 PsiBlast_PDB 92.4865%-160 - C5 -3HQ5 PRGR_HUMAN A:[5-255] -------------------------------------------------QLIPPLINLLMSIEPDVIYAGHDN---DTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQ---MLYFAPDLILNEQR-K-ESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTI--PLEGLRSQTQFEEMRSSYIRELIKAIGLR-KGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHK-
63 PsiBlast_CBE 92.3951%-162 - C5 -2QPY A:[3-249] ----------------------------------------------------PIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSR---MLYFAPDLVFNEYRMH-KSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSII--PVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFH--
35 PsiBlast_CBE 92.2765%-156 - C5 -3KBA B:[2-251] -------------------------------------------------QLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQ---MLYFAPDLILNEQRMK-ESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTI--PLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFH--
19 PsiBlast_PDB 92.2760%-150 - C5 -4LTW ? A:[3-251] ---------------------------------------------------APSLISILQAIEPEVVYAGYDNTQPDTTNYLLSSLNRLAEKQLVSVVKWAKALPGFRNLHLDDQMTLIQYSWMGLMAFAMGWRSYKHTNGQ---MLYFAPDLIFNEQRMQ-QSAMYDLCQGMQQISQEFVRLQVTQEEFLCMKALLLLSTV--PKEGLKSQASFDEMRMNYIKELNRAIAKKENNSAQNWQRFYQLTKLLDSMHDLVGGLLQFCFYTFVQSQALSVEFPEMLVEIISAQLPKVLAGMAKPLLFHK-
6 PsiBlast_PDB 92.2565%-155 - C5 -4A2J PRGR_HUMAN A:[10-259] --------------------------------------------------LIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQ---MLYFAPDLILNEQRMK-ESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTI--PLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHK-
15 PsiBlast_PDB 92.2164%-156 - C5 -1ZUC B:[8-258] -------------------------------------------------QLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQ---MLYFAPDLILNEQRMK-ESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTI--PLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHK-
2 PsiBlast_PDB 92.1165%-153 - C5 -2W8Y PRGR_HUMAN A:[10-260] --------------------------------------------------LIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQ---MLYFAPDLILNEQRMK-ESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTI--PLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHKK
33 PsiBlast_CBE 91.9064%-157 - C5 -1SR7 B:[9-257] --------------------------------------------------LIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQ---MLYFAPDLILNEQRMK-ESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTI--PLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFH--
7 PsiBlast_PDB 91.4765%-151 - C5 -4APU PRGR_HUMAN A:[10-259] --------------------------------------------------LIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQ---MLYFAPDLILNEQRMK-ESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTI--PLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHK-
5 PsiBlast_PDB 91.3965%-148 - C5 -3ZRB PRGR_HUMAN A:[10-259] --------------------------------------------------LIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQ---MLYFAPDLILNEQRMK-ESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTI--PLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHK-
34 PsiBlast_CBE 91.2564%-152 - C5 -1SQN B:[11-261] --------------------------------------------------LIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQ---MLYFAPDLILNEQRMK-ESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTI--PLEGLRSQTQFEEMRSSYIRELIKAIGLRQ-GVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHKK
30 PsiBlast_CBE 91.2164%-151 - C5 -3D90 B:[8-257] --------------------------------------------------LIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQ---MLYFAPDLILNEQRMK-ESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTI--PLEGLRSQTQFEEMRSSYIRELIKAIGLRQ-GVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHK-
13 PsiBlast_PDB 91.1664%-148 - C5 -3D90 PRGR_HUMAN A:[7-256] -------------------------------------------------QLIPPLINLLMSIEPDVIYAGHDN--PDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQ---MLYFAPDLILNEQRMK-ESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTI--PLEGLRSQTQFEEMRSSYIRELIKAIGLRQ-GVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFH--
64 PsiBlast_CBE 91.1351%-144 - C5 -2PKL A:[3-249] ----------------------------------------------------PIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSR---MLYFAPDLVFNEYRMH-KSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSII--PVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFH--
4 PsiBlast_PDB 91.0165%-154 - C5 -3ZRA PRGR_HUMAN A:[10-259] --------------------------------------------------LIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQ---MLYFAPDLILNEQRMK-ESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTI--PLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHK-
8 PsiBlast_PDB 90.9765%-154 - C5 -1A28 PRGR_HUMAN A:[5-255] -------------------------------------------------QLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQ---MLYFAPDLILNEQRMK-ESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTI--PLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHK-
91 HHSearch 90.7665%-154 - C5 -1SQN PRGR_HUMAN A:[10-260] -------------------------------------------------QLIPPLINLLMSIEPDVIYAGHDN--PDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQ---MLYFAPDLILNEQRMK-ESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTI--PLEGLRSQTQFEEMRSSYIRELIKAIGLRQ-GVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHK-
22 PsiBlast_CBE 90.7665%-153 - C5 -4APU B:[10-259] --------------------------------------------------LIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQ---MLYFAPDLILNEQRMK-ESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTI--PLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHK-
31 PsiBlast_CBE 90.6564%-156 - C5 -1E3K B:[8-256] --------------------------------------------------LIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQ---MLYFAPDLILNEQRMK-ESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTI--PLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFH--
24 PsiBlast_CBE 90.6565%-155 - C5 -3ZRB B:[10-259] --------------------------------------------------LIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQ---MLYFAPDLILNEQRMK-ESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTI--PLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHK-
17 PsiBlast_PDB 90.4464%-154 - C5 -1SQN PRGR_HUMAN A:[10-260] -------------------------------------------------QLIPPLINLLMSIEPDVIYAGHDN--PDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQ---MLYFAPDLILNEQRMK-ESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTI--PLEGLRSQTQFEEMRSSYIRELIKAIGLRQ-GVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHK-
32 PsiBlast_CBE 90.4264%-149 - C5 -1ZUC PRGR_HUMAN A:[8-258] -------------------------------------------------QLIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQ---MLYFAPDLILNEQRMK-ESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTI--PLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHK-
25 PsiBlast_CBE 90.1265%-149 - C5 -3ZRA B:[10-259] --------------------------------------------------LIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQ---MLYFAPDLILNEQRMK-ESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTI--PLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHK-
36 PsiBlast_CBE 89.8060%-146 - C5 -4FN9 ? B:[5-252] ---------------------------------------------------APSLISILQAIEPEVVYAGYDNTQPDTTNYLLSSLNRLAEKQLVSVVKWAKALPGFRNLHLDDQMTLIQYSWMGLMAFAMGWRSYKHTNGQ---MLYFAPDLIFNEQRMQ-QSAMYDLCQGMQQISQEFVRLQVTQEEFLCMKALLLLSTV--PKEGLKSQASFDEMRMNYIKELNRAIAKKENNSAQNWQRFYQLTKLLDSMHDLVGGLLQFCFYTFVQSQALSVEFPEMLVEIISAQLPKVLAGMAKPLLFH--
70 PsiBlast_CBE 89.7351%-153 - C5 -2PIR A:[3-249] ----------------------------------------------------PIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSR---MLYFAPDLVFNEYRMH-KSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSII--PVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFH--
1 PsiBlast_PDB 89.6664%-152 - C5 -3G8O PRGR_HUMAN A:[12-262] -------------------------------------------------QLIPPLINLLMSIEPDVIYAGHDNTK-DTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQ---MLYFAPDLILNEQRMK-ESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTI--PLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHK-
62 PsiBlast_CBE 89.5751%-156 - C5 -2HVC A:[3-249] ----------------------------------------------------PIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSR---MLYFAPDLVFNEYRMH-KSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSII--PVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFH--
14 PsiBlast_PDB 89.5564%-153 - C5 -1SR7 PRGR_HUMAN A:[8-258] -------------------------------------------------QLIPPLINLLMSIEPDVIYAGHDN--PDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQ---MLYFAPDLILNEQRMK-ESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTI--PLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHK-
77 PsiBlast_CBE 89.5053%-155 - C5 -4E2J ? B:[4-250] ----------------------------------------------------PTLISLLEVIEPEVLYSGYDSTLPDTSTRLMSTLNRLGGRQVVSAVKWAKALPGFRNLHLDDQMTLLQYSWMSLMAFSLGWRSYKQSNGN---MLCFAPDLVINEERMQ-LPYMYDQCQQMLKISSEFVRLQVSYDEYLCMKVLLLLSTV--PKDGLKSQAVFDEIRMTYIKELGKAIVKREGNSSQNWQRFYQLTKLLDSMHEMVGGLLQFCFYTFVNK-SLSVEFPEMLAEIISNQLPKFKAGSVKPLLFHQ-
69 PsiBlast_CBE 89.5051%-151 - C5 -2PIT A:[3-249] ----------------------------------------------------PIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSR---MLYFAPDLVFNEYRMH-KSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSII--PVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFH--
27 PsiBlast_CBE 89.4465%-150 - C5 -2W8Y B:[10-260] --------------------------------------------------LIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQ---MLYFAPDLILNEQRMK-ESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTI--PLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHKK
37 PsiBlast_CBE 89.3460%-143 - C5 -4FN9 ? A:[5-253] ---------------------------------------------------APSLISILQAIEPEVVYAGYDNTQPDTTNYLLSSLNRLAEKQLVSVVKWAKALPGFRNLHLDDQMTLIQYSWMGLMAFAMGWRSYKHTNGQ---MLYFAPDLIFNEQRMQ-QSAMYDLCQGMQQISQEFVRLQVTQEEFLCMKALLLLSTV--PKEGLKSQASFDEMRMNYIKELNRAIAKKENNSAQNWQRFYQLTKLLDSMHDLVGGLLQFCFYTFVQSQALSVEFPEMLVEIISAQLPKVLAGMAKPLLFHK-
26 PsiBlast_CBE 89.2965%-152 - C5 -3ZR7 B:[10-259] --------------------------------------------------LIPPLINLLMSIEPDVIYAGHDN----TSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQ---MLYFAPDLILNEQRMK-ESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTI--PLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHK-
57 PsiBlast_CBE 89.2151%-157 - C5 -3B5R A:[1-247] ----------------------------------------------------PIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSR---MLYFAPDLVFNEYRMH-KSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSII--PVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFH--
18 PsiBlast_PDB 89.1765%-165 - C5 -3KBA PRGR_HUMAN A:[2-253] -------------------------------------------------QLIPPLINLLMSIEPDVIYAGHD-----TSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQ---MLYFAPDLILNEQRMK-E--FYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTI--PLEGLRSQTQFEEMRSSYIRELIKAIGLR-KGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHKK
23 PsiBlast_CBE 89.1365%-154 - C5 -4A2J B:[10-259] --------------------------------------------------LIPPLINLLMSIEPDVIYAGHDNTKPDTSSSLLTSLNQLGERQLLSVVKWSKSLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQ---MLYFAPDLILNEQRMK-ESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTI--PLEGLRSQTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQSRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHK-
44 PsiBlast_CBE 89.0851%-153 - C5 -4OJ9 A:[2-248] ----------------------------------------------------PIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSA---MLYFAPDLVFNEYRMH-KSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSII--PVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFAFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFH--
71 PsiBlast_CBE 89.0251%-155 - C5 -2PIQ ? A:[3-249] ----------------------------------------------------PIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSR---MLYFAPDLVFNEYRMH-KSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSII--PVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFH--
58 PsiBlast_CBE 89.0251%-157 - C5 -2YHD A:[1-247] ----------------------------------------------------PIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSR---MLYFAPDLVFNEYRMH-KSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSII--PVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFH--
49 PsiBlast_CBE 89.0251%-147 - C5 -3L3X A:[3-249] ----------------------------------------------------PIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSR---MLYFAPDLVFNEYRMH-KSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSII--PVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFH--
53 PsiBlast_CBE 89.0051%-153