@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : ANM2_MOUSE: (2014-04-04 )
MEAPGEGPCSESQVIPVLEEDPVDYGCEMQLLQDGAQLQLQLQPEEFVAIADYTATDETQLSFLRGEKILILRQTTADWWWGERAGCCGYIPANHLGKQLEEYDPEDTWQDEEYFDSYGTLKLHLEMLADQPRTTKYHSVILQNKESLKDKVILDVGCGTGIISLFCAHHARPKAVYAVEASDMAQHTSQLVLQNGFADTITVFQQKVEDVVLPEKVDVLVSEWMGTCLLFEFMIESILYARDTWLKGDGIIWPTTAALHLVPCSAEKDYHSKVLFWDNAYEFNLSALKSLAIKEFFSRPKSNHILKPEDCLSEPCTILQLDMRTVQVPDLETMRGELRFDIQKAGTLHGFTAWFSVYFQSLEEGQPQQVVSTGPLHPTTHWKQTLFMMDDPVPVHTGDVVHGFCCVTKKSGMEKAHVCLSELGCHVRTRSHVSTELETGSFRSGGDS

Atome Classification :

(20 SA) .........10........20........30........40........50........60........70........80........90........100.......110.--......120.......130.......140.......150.......160.......170.......180.......190.......200.......210..-.....220.......230.......240.......250.......260.......270-..---.....--..280-.........290....--...300........310.........320.-......330...-......340.......350.......360.......370........380.......390.......400.......410.......420.......430.......440......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MEAPGEGPCSESQVIPVLEEDPVDYGCEMQLLQDGAQLQLQLQPEEFVAIADYTATDETQLSFLRGEKILILRQTTADWWWGERAGCCGYIPANHLGKQLEEYDPEDTWQDEE--YFDSYGTLKLHLEMLADQPRTTKYHSVILQNKESLKDKVILDVGCGTGIISLFCAHHARPKAVYAVEASDMAQHTSQLVLQNGFADTITVFQQKVEDVVLP-EKVDVLVSEWMGTCLLFEFMIESILYARDTWLKGDGIIWPTTAALHLVPCSAEKDY---HS---KVLFW--DNA---YEFNLSALKSLAIKEF--FSRPK-SNHILKPED--CLSEPCTILQLDM-RTVQVPD--LET-MRGELRFDIQKAGTLHGFTAWFSVYFQSLEEGQPQQV-VSTGPLHPTTHWKQTLFMMDDPVPVHTGDVVHGFCCVTKKSGMEKAHVCLSELGCHVRTRSHVSTELETGSFRSGGDS
78 HHSearch 90.5436%-120 - C1 -4HC4 ANM6_HUMAN A:[49-375] --------------------------------------------------------------------------------------------------------------------YECYSDVSVHEEMIADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCAQ-AGARRVYAVEASAIWQQAREVVRFNGLEDRVHVLPGPVETVELP-EQVDAIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPASAELFIVPISDQM-L---EW---RLGFW--SQVKQHYGVDMSCLEGFATRCLMGHSEIV-VQ-GLSGED--VLARPQRFAQLEL-SRAGLEQELEAG-VGGRFRCSCYGSAPMHGFAIWFQVTFPGG---EKPLV-LSTSPFHPATHWKQALLYLNEPVQVEQDTDVSGEITLLP-SRDNPRRLRVL-LRYKVGDQEEK---TKDFAME-----
77 HHSearch 89.6038%-115 * C1 *2FYT ANM3_HUMAN A:[30-333] --------------------------------------------------------------------------------------------------------------------FSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAK-AGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYLAKGGSVYPDICTISLVAVSDVNKH---AD---RIAFW--DDV---YGFKMSCMKKAVIPE------A--VVEVLDPKT--LISEPCGIKHIDC-HTTSISD--LE--FSSDFTLKITRTSMCTAIAGYFDIYFEK--NCHNRVV-FSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKNKKDPRSLTVTLTLNNS----------------------
23 PsiBlast_CBE 88.5237%-121 - C1 -2Y1W CARM1_HUMAN D:[14-306] ----------------------------------------------------------------------------------------------------------------Q--YFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQ-AGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLP-EQVDIIISEPMGYMLFNERMLESYLHAKK-YLKPSGNMFPTIGDVHLAPFTDEQLYMEQFT---KANFWYQPSF---HGVDLSALRGAAVDEY--FRQP-----VVDTFDIRILMAKSVKYTVNF-LEAKEGD--LHR-IEIPFKFHMLHSGLVHGLAFWFDVAFI----GSIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKAGDTLSGTCLL-----------------------------------------
18 PsiBlast_CBE 88.4837%-124 - C1 -3B3F CARM1_RAT C:[10-302] ----------------------------------------------------------------------------------------------------------------Q--YFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQ-AGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLP-EQVDIIISEPMGYMLFNERMLESYLHAKK-YLKPSGNMFPTIGDVHLAPFTDEQLYMEQFT---KANFWYQPSF---HGVDLSALRGAAVDEY--FRQP-----VVDTFDIRILMAKSVKYTVNF-LEAKEGD--LHR-IEIPFKFHMLHSGLVHGLAFWFDVAFI----GSIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKAGDTLSGTCLL-----------------------------------------
2 PsiBlast_PDB 88.3836%-107 - C1 -1F3L ANM3_RAT A:[1-319] ----------------------------------------------------------------------------------------------------------DLQEDEDGVYFSSYGHYGIHEEMLKDKVRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAK-AGAKKVIAVDQSEILYQAMDIIRLNKLEDTIVLIKGKIEEVSLPVEKVDVIISEWMGYFLLFESMLDSVLYAKSKYLAKGGSVYPDICTISLVAVSDVSKH---AD---RIAFW--DDV---YGFNMSCMKKAVIPEA--VVE------VVDHKT--LISDPCDIKHIDC-HTTSISD--LE--FSSDFTLRTTKTAMCTAVAGYFDIYFE--KNCHNRVV-FSTGPQSTKTHWKQTIFLLEKPFPVKAGEALKGKITVHKNKKDPRSLIVTLTLNSSTQTYS-----------------
7 PsiBlast_PDB 87.9939%-110 - C1 -4HC4 ANM6_HUMAN A:[49-340] --------------------------------------------------------------------------------------------------------------------YECYSDVSVHEEMIADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCAQ-AGARRVYAVEASAIWQQAREVVRFNGLEDRVHVLPGPVETVELP-EQVDAIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPASAELFIVPIS-DQML---EW---RLGFW--SQVKQHYGVDMSCLEGFATRCL--MGHSEIVVQGLSGED--VLARPQRFAQLELSRAGLEQE--LEAGVGGRFRCSCYGSAPMHGFAIWFQVTFPGG--EKP-LV-LSTSPFHPATHWKQALLYLNEPVQVEQDTDVSG---------------------------------------------
12 PsiBlast_PDB 87.9137%-120 - C1 -2Y1X CARM1_HUMAN A:[14-306] ----------------------------------------------------------------------------------------------------------------Q--YFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQ-AGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLP-EQVDIIISEPMGYMLFNERMLESYLHAKK-YLKPSGNMFPTIGDVHLAPFTDEQLYMEQFT---KANFWYQPSF---HGVDLSALRGAAVDEY--FRQP-----VVDTFDIRILMAKSVKYTVNF-LEAKEGD--LHR-IEIPFKFHMLHSGLVHGLAFWFDVAFI----GSIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKAGDTLSGTCLL-----------------------------------------
32 PsiBlast_CBE 87.8637%-121 - C1 -2V74 CARM1_MOUSE D:[5-297] ----------------------------------------------------------------------------------------------------------------Q--YFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQ-AGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLP-EQVDIIISEPMGYMLFNERMLESYLHAKK-YLKPSGNMFPTIGDVHLAPFTDEQLYMEQFT---KANFWYQPSF---HGVDLSALRGAAVDEY--FRQP-----VVDTFDIRILMAKSVKYTVNF-LEAKEGD--LHR-IEIPFKFHMLHSGLVHGLAFWFDVAFI----GSIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKAGDTLSGTCLL-----------------------------------------
80 HHSearch 87.4035%-111 - C1 -4IKP CARM1_HUMAN A:[5-317] ------------------------------------------------------------------------------------------------------------SSAVQ--YFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQ-AGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLP-EQVDIIISEPMGYMLFNERMLESYLHAK-KYLKPSGNMFPTIGDVHLAPFTDEQLY---MEQFTKANFWYQPSF---HGVDLSALRGAAVDEY--FRQPV-VD-TFDIRI--LMAKSVK-YTVNF-LEAKEGD--LHR-IEIPFKFHMLHSGLVHGLAFWFDVAFIGS---IMTVW-LSTAPTEPLTHWYQVRCLFQSPLFAKAGDTLSGTCLLIANKRQSYDISIVAQV-------------------------
11 PsiBlast_PDB 87.3837%-121 - C1 -2Y1W CARM1_HUMAN A:[14-306] ----------------------------------------------------------------------------------------------------------------Q--YFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQ-AGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLP-EQVDIIISEPMGYMLFNERMLESYLHAKK-YLKPSGNMFPTIGDVHLAPFTDEQLYMEQFT---KANFWYQPSF---HGVDLSALRGAAVDEY--FRQP-----VVDTFDIRILMAKSVKYTVNF-LEAKEGD--LHR-IEIPFKFHMLHSGLVHGLAFWFDVAFI----GSIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKAGDTLSGTCLL-----------------------------------------
20 PsiBlast_CBE 87.2937%-119 - C1 -2Y1X CARM1_HUMAN D:[14-306] ----------------------------------------------------------------------------------------------------------------Q--YFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQ-AGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLP-EQVDIIISEPMGYMLFNERMLESYLHAKK-YLKPSGNMFPTIGDVHLAPFTDEQLYMEQFT---KANFWYQPSF---HGVDLSALRGAAVDEY--FRQP-----VVDTFDIRILMAKSVKYTVNF-LEAKEGD--LHR-IEIPFKFHMLHSGLVHGLAFWFDVAFI----GSIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKAGDTLSGTCLL-----------------------------------------
9 PsiBlast_PDB 87.0737%-123 - C1 -3B3G - CARM1_RAT A:[155-441] ------------------------------------------------------------------------------------------------------------------------GYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQ-AGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLP-EQVDIIISEPMGYMLFNERMLESYLHAKK-YLKPSGNMFPTIGDVHLAPFTDEQLYMEQFT---KANFWYQPSF---HGVDLSALRGAAVDEY--FRQP-----VVDTFDIRILMAKSVKYTVNF-LEAKEGD--LHR-IEIPFKFHMLHSGLVHGLAFWFDVAFI----GSIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKAGDTLSGTCLL-----------------------------------------
19 PsiBlast_CBE 87.0437%-123 - C1 -3B3F CARM1_RAT B:[10-302] ----------------------------------------------------------------------------------------------------------------Q--YFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQ-AGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLP-EQVDIIISEPMGYMLFNERMLESYLHAKK-YLKPSGNMFPTIGDVHLAPFTDEQLYMEQFT---KANFWYQPSF---HGVDLSALRGAAVDEY--FRQP-----VVDTFDIRILMAKSVKYTVNF-LEAKEGD--LHR-IEIPFKFHMLHSGLVHGLAFWFDVAFI----GSIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKAGDTLSGTCLL-----------------------------------------
30 PsiBlast_CBE 87.0237%-119 - C1 -2V74 CARM1_MOUSE H:[5-297] ----------------------------------------------------------------------------------------------------------------Q--YFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQ-AGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLP-EQVDIIISEPMGYMLFNERMLESYLHAKK-YLKPSGNMFPTIGDVHLAPFTDEQLYMEQFT---KANFWYQPSF---HGVDLSALRGAAVDEY--FRQP-----VVDTFDIRILMAKSVKYTVNF-LEAKEGD--LHR-IEIPFKFHMLHSGLVHGLAFWFDVAFI----GSIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKAGDTLSGTCLL-----------------------------------------
25 PsiBlast_CBE 86.9137%-120 - C1 -2Y1W CARM1_HUMAN B:[14-306] ----------------------------------------------------------------------------------------------------------------Q--YFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQ-AGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLP-EQVDIIISEPMGYMLFNERMLESYLHAKK-YLKPSGNMFPTIGDVHLAPFTDEQLYMEQFT---KANFWYQPSF---HGVDLSALRGAAVDEY--FRQP-----VVDTFDIRILMAKSVKYTVNF-LEAKEGD--LHR-IEIPFKFHMLHSGLVHGLAFWFDVAFI----GSIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKAGDTLSGTCLL-----------------------------------------
21 PsiBlast_CBE 86.8737%-120 - C1 -2Y1X CARM1_HUMAN C:[14-306] ----------------------------------------------------------------------------------------------------------------Q--YFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQ-AGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLP-EQVDIIISEPMGYMLFNERMLESYLHAKK-YLKPSGNMFPTIGDVHLAPFTDEQLYMEQFT---KANFWYQPSF---HGVDLSALRGAAVDEY--FRQP-----VVDTFDIRILMAKSVKYTVNF-LEAKEGD--LHR-IEIPFKFHMLHSGLVHGLAFWFDVAFI----GSIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKAGDTLSGTCLL-----------------------------------------
22 PsiBlast_CBE 86.8337%-119 - C1 -2Y1X CARM1_HUMAN B:[14-306] ----------------------------------------------------------------------------------------------------------------Q--YFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQ-AGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLP-EQVDIIISEPMGYMLFNERMLESYLHAKK-YLKPSGNMFPTIGDVHLAPFTDEQLYMEQFT---KANFWYQPSF---HGVDLSALRGAAVDEY--FRQP-----VVDTFDIRILMAKSVKYTVNF-LEAKEGD--LHR-IEIPFKFHMLHSGLVHGLAFWFDVAFI----GSIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKAGDTLSGTCLL-----------------------------------------
8 PsiBlast_PDB 86.7937%-124 - C1 -3B3F CARM1_RAT A:[10-302] ----------------------------------------------------------------------------------------------------------------Q--YFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQ-AGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLP-EQVDIIISEPMGYMLFNERMLESYLHAKK-YLKPSGNMFPTIGDVHLAPFTDEQLYMEQFT---KANFWYQPSF---HGVDLSALRGAAVDEY--FRQP-----VVDTFDIRILMAKSVKYTVNF-LEAKEGD--LHR-IEIPFKFHMLHSGLVHGLAFWFDVAFI----GSIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKAGDTLSGTCLL-----------------------------------------
28 PsiBlast_CBE 86.7337%-122 - C1 -4IKP CARM1_HUMAN B:[9-301] ----------------------------------------------------------------------------------------------------------------Q--YFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQ-AGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLP-EQVDIIISEPMGYMLFNERMLESYLHAKK-YLKPSGNMFPTIGDVHLAPFTDEQLYMEQFT---KANFWYQPSF---HGVDLSALRGAAVDEY--FRQP-----VVDTFDIRILMAKSVKYTVNF-LEAKEGD--LHR-IEIPFKFHMLHSGLVHGLAFWFDVAFI----GSIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKAGDTLSGTCLL-----------------------------------------
24 PsiBlast_CBE 86.7237%-120 - C1 -2Y1W CARM1_HUMAN C:[14-306] ----------------------------------------------------------------------------------------------------------------Q--YFQFYGYLSQQQNMMQDYVRTGTYQRAILQNHTDFKDKIVLDVGCGSGILSFFAAQ-AGARKIYAVEASTMAQHAEVLVKSNNLTDRIVVIPGKVEEVSLP-EQVDIIISEPMGYMLFNERMLESYLHAKK-YLKPSGNMFPTIGDVHLAPFTDEQLYMEQFT---KANFWYQPSF---HGVDLSALRGAAVDEY--FRQP-----VVDTFDIRILMAKSVKYTVNF-LEAKEGD--LHR-IEIPFKFHMLHSGLVHGLAFWFDVAFI----GSIMTVWLSTAPTEPLTHWYQVRCLFQSPLFAKAGDTLSGTCLL-----------------------------------------


User Run : PsiBlast Ligand Search Result:

(40 SA) .........10........20........30........40........50........60........70.-.....--..80.--..--.---...---.90........100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210..-.....220.......230.......240.......250.......260.......270.......280-.........290....--...300.......310.......320.......330.........340.......350.......360.......370.......380.......390.......400.......410.......420.......430.......440......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MEAPGEGPCSESQVIPVLEEDPVDYGCEMQLLQDGAQLQLQLQPEEFVAIADYTATDETQLSFLRGEKILIL-RQTTA--DWWWG--ER--A---GCC---GYIPANHLGKQLEEYDPEDTWQDEEYFDSYGTLKLHLEMLADQPRTTKYHSVILQNKESLKDKVILDVGCGTGIISLFCAHHARPKAVYAVEASDMAQHTSQLVLQNGFADTITVFQQKVEDVVLP-EKVDVLVSEWMGTCLLFEFMIESILYARDTWLKGDGIIWPTTAALHLVPCSAEKDYHSKVLFWDNA---YEFNLSALKSLAIKEF--FSRPKSNHILKPEDCLSEPCTILQLDMRTVQVPD--LETMRGELRFDIQKAGTLHGFTAWFSVYFQSLEEGQPQQVVSTGPLHPTTHWKQTLFMMDDPVPVHTGDVVHGFCCVTKKSGMEKAHVCLSELGCHVRTRSHVSTELETGSFRSGGDS
101 86.1434%-116 - C- -4QQK ANM6_HUMAN A:[50-375] --------------------------------------------------------------------------------------------------------------------------------ECYSDVSVHEEMIADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCAQ-AGARRVYAVEASAIWQQAREVVRFNGLEDRVHVLPGPVETVELP-EQVDAIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPASAELFIVPISDQML-EWRLGFWSQVKQHYGVDMSCLEGFATRCLMGHSEIVVQ-GLSGEDVLARPQRFAQLELSRAGLEQELEAGVGGRFRCSCYGSAPMHGFAIWFQVTFPGGE---KPLVLSTSPFHPATHWKQALLYLNEPVQVEQDTDVSGEITLLP-SRDNPRRLRVL-LRYKVGDQEEK---TKDFAME-----
102 86.0334%-115 - C- -4QPP ANM6_HUMAN A:[48-375] ------------------------------------------------------------------------------------------------------------------------------YYECYSDVSVHEEMIADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCAQ-AGARRVYAVEASAIWQQAREVVRFNGLEDRVHVLPGPVETVELP-EQVDAIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPASAELFIVPISDQML-EWRLGFWSQVKQHYGVDMSCLEGFATRCLMGHSEIVVQ-GLSGEDVLARPQRFAQLELSRAGLEQELEAGVGGRFRCSCYGSAPMHGFAIWFQVTFPGGES-EKPLVLSTSPFHPATHWKQALLYLNEPVQVEQDTDVSGEITLLP-SRDNPRRLRVL-LRYKVGDQEEK---TKDFAME-----
103 84.7734%-118 - C- -4C05 ANM6_MOUSE A:[60-380] ------------------------------------------------------------------------------------------------------------------------------------DVSVHEEMIADQVRTEAYRLGILKNWAALRGKTVLDVGAGTGILSIFCAQ-AGARRVYAVEASAIWQQAREVVRLNGLEDRVHVLPGPVETVELP-ERVDAIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPASAELFVAPISDQML-EWRLGFWSQVKQHYGVDMSCMESFATRCLMGHSEIVVQD-LSGEDVLARPQRFAQLELARAGLEQELEAGVGGRFRCSCYGSAPLHGFAVWFQVTFPG----EKPLVLSTSPLHPATHWKQALLYLNEPVPVEQDTDISGEITLLP-SPDNPRRLRIL-LRYKVGDHEEK---TKDFAM------
98 83.0736%-121 - C- -4QQN ? A:[36-337] -------------------------------------------------------------------------------------------------------------------------------------YGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAK-AGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYLAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDV---YGFKMSCMKKAVIPEA-------VVEVLDPKTLISEPCGIKHIDCHTTSISD--LE-FSSDFTLKITRTSMCTAIAGYFDIYFE--KNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKN-----SLTVTLTLNNSTQTY------------------
99 82.4036%-121 - C- -4HSG ANM3_HUMAN A:[36-337] -------------------------------------------------------------------------------------------------------------------------------------YGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAK-AGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYLAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDV---YGFKMSCMKKAVIPEA-------VVEVLDPKTLISEPCGIKHIDCHTTSISD--LE-FSSDFTLKITRTSMCTAIAGYFDIYFE--KNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHK------SLTVTLTLNNSTQTY------------------
100 81.2536%-122 - C- -3SMQ ANM3_HUMAN A:[35-337] ------------------------------------------------------------------------------------------------------------------------------------HYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAK-AGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYLAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDV---YGFKMSCMKKAVIPEA-------VVEVLDPKTLISEPCGIKHIDCHTTSISD--LE-FSSDFTLKITRTSMCTAIAGYFDIYFE--KNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHK------SLTVTLTLNNSTQTY------------------
111 26.2942% -30 - C- -4AFZ ? C:[9-66] ----------------------------------------------FVALYDYNATRWTDLSFHKGEKFQIL-EFGPG--DWWEA--RSLTT---GET---GYIPSNYVA-------PVDSI-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
114 25.5945% -47 - C- -4D8D C:[4-56] ----------------------------------------------FVALYDYEAWTEDDLSFHKGEKFQIL-NSSEG--DWWEA--RSLTT---GET---GYIPSNYVA-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
124 25.2633% -56 - C- -1WLP B:[81-134] --------------------------------------------EPYVAIKAYTAVEGDEVSLLEGEAVEVI-HKLLD--GWWVI--RK--D---DVT---GYFPSMYLQK----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
110 25.2445% -38 - C- -3UA6 FYN_HUMAN A:[8-60] ----------------------------------------------FVALYDYEARTEDDLSFHKGEKFQIL-NSSEG--DWWEA--RSLTT---GET---GYIPSNYVA-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
109 25.0045% -31 - C- -1FYN A:[7-59] ----------------------------------------------FVALYDYEARTEDDLSFHKGEKFQIL-NSSEG--DWWEA--RSLTT---GET---GYIPSNYVA-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
125 24.9633% -48 - C- -1OV3 NCF1_HUMAN A:[82-135] --------------------------------------------EPYVAIKAYTAVEGDEVSLLEGEAVEVI-HKLLD--GWWVI--RK--D---DVT---GYFPSMYLQK----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
119 24.7740% -27 - C- -4AFQ ? C:[9-66] ----------------------------------------------FVALYDYQADRWTDLSFHKGEKFQIL-DASPP--GDWWE--AR--SLTTGET---GYIPSNYVA-------PVDS------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
112 24.7645% -29 - C- -3H0F A:[18-70] ----------------------------------------------FVALYDYEAWTEDDLSFHKGEKFQIL-NSSEG--DWWEA--RSLTT---GET---GYIPSNYVA-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
142 24.0633% -36 - C- -1SSH A:[7-57] -----------------------------------------------VALYSFAGEESGDLPFRKGDVITIL-KKSDSQNDWWTG--RV--N---GRE---GIFPANYV------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
117 24.0539% -30 - C- -4ESR B:[10-62] -----------------------------------------------VALYDYTANRSDELTIHRGDIIRVF-FKDNE--DWWYG--SI--GK--GQE---GYFPANHVASE---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
138 23.6134% -28 - C- -3GBQ GRB2_MOUSE A:[11-62] ---------------------------------------------EAIAKYDFKATADDELSFKRGDILKVLNEECDQ--NWYKA--EL--N---GKD---GFIPKNYI------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
137 23.5234% -31 - C- -4GBQ GRB2_MOUSE A:[11-62] ---------------------------------------------EAIAKYDFKATADDELSFKRGDILKVLNEECDQ--NWYKA--EL--N---GKD---GFIPKNYI------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
136 23.2334% -37 - C- -1AZE GRB2_HUMAN A:[2-53] ---------------------------------------------EAIAKVDFKATADDELSFKRGDILKVLNEESDQ--NWYKA--EL--N---GKD---GFIPKNYI------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
140 23.1934% -35 - C- -1GBR GRB2_MOUSE A:[11-62] ---------------------------------------------EAIAKYDFKATADDELSFKRGDILKVLNEECDQ--NWYKA--EL--N---GKD---GFIPKNYI------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
122 23.1234% -27 - C- -1UJ0 A:[10-61] ------------------------------------------------ALYDFEAVEDNELTFKHGELITVL-DDSDA--NWWQG--EN--H---RGT---GLFPSNFVTTDL--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
141 22.8134% -25 - C- -1GBQ GRB2_MOUSE A:[11-62] ---------------------------------------------EAIAKYDFKATADDELSFKRGDILKVLNEECDQ--NWYKA--EL--N---GKD---GFIPKNYI------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
139 22.5234% -24 - C- -2GBQ GRB2_MOUSE A:[11-62] ---------------------------------------------EAIAKYDFKATADDELSFKRGDILKVLNEECDQ--NWYKA--EL--N---GKD---GFIPKNYI------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
133 22.4634% -27 - C- -2RPN A:[9-55] ---------------------------------------------------DYDAAEDNELTFVENDKIINI-EFVDD--DWWLGELEK--D---GSK---GLFPSNYV------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
145 22.2634% -26 - C- -2XMF A:[10-59] ------------------------------------------------ALYAYDAQDTDELSFNANDIIDII-KEDPS--GWWTG--RL--R---GKQ---GLFPNNYVTK----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
120 22.1837% -25 - C- -2DRM MYSB_ACACA A:[8-55] ------------------------------------------------ALYDYDAQTGDELTFKEGDTIIVH-QKDPA--GWWEG--EL--N---GKR---GWVPANYV------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
129 22.1633% -25 - C- -2DF6 ARHG7_RAT A:[12-56] ---------------------------------------------------NFQQTNEDELSFSKGDVIHVT-RVEEG--GWWEG--TH--N---GRT---GWFPSNYV------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
126 22.0133% -19 - C- -2P4R ARHG7_RAT A:[12-56] ---------------------------------------------------NFQQTNEDELSFSKGDVIHVT-RVEEG--GWWEG--TH--N---GRT---GWFPSNYV------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
121 21.9137% -25 - C- -2DRK A:[9-56] ------------------------------------------------ALYDYDAQTGDELTFKEGDTIIVH-QKDPA--GWWEG--EL--N---GKR---GWVPANYV------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
127 21.7933% -13 - C- -2G6F ARHG7_RAT X:[12-56] ---------------------------------------------------NFQQTNEDELSFSKGDVIHVT-RVEEG--GWWEG--TH--N---GRT---GWFPSNYV------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
152 21.4032% -18 - C- -2D1X SRC8_HUMAN A:[14-62] -----------------------------------------------VALYDYQAAGDDEISFDPDDIITNI-EMIDD--GWWRG--VC--K---GRY---GLFPANYV------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
130 21.1933% -14 - C- -2AK5 ARHG7_RAT B:[14-58] ---------------------------------------------------NFQQTNEDELSFSKGDVIHVT-RVEEG--GWWEG--TH--N---GRT---GWFPSNYV------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
132 20.8633% -13 - C- -2OI3 HCK_HUMAN A:[29-80] -----------------------------------------------VALYDYEAIHHEDLSFQKGDQMVVL-EESGE----WWK--AR--S---LATRKEGYIPSNYVAR----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
135 20.8433% -10 - C- -1ZSG A:[16-60] ---------------------------------------------------NFQQTNEDELSFSKGDVIHVT-RVEEG--GWWEG--TL--N---GRT---GWFPSNYV------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
131 20.4833% -10 - C- -2OJ2 HCK_HUMAN A:[29-80] -----------------------------------------------VALYDYEAIHHEDLSFQKGDQMVVL-EESGE----WWK--AR--S---LATRKEGYIPSNYVAR----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
149 19.1531% 10 - C- -1W70 NCF4_HUMAN A:[9-52] ------------------------------------------------ALFDFTGNSKLELNFKAGDVIFLL-SRINK--DWLEG--TV--R---GAT---GIFP----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
148 15.6531% 70 - C- -2O31 A:[8-48] ---------------------------------------------EAIAKFNFNGDTQVEMSFRKGERITLL-RQVDE--NWYEG--RI--P---G-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
146 15.2231% 80 - C- -2O9V A:[8-48] ---------------------------------------------EAIAKFNFNGDTQVEMSFRKGERITLL-RQVDE--NWYEG--RI--P---G-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
153 14.6632% 88 - C- -2RQU A:[7-43] -------------------------------------------------IYDCQADNDDELTFIEGEVIIVT-GEEDQ--EWWIG--HI--E---G-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
150 1.2753% 358 - C- -3FVE DAPF_MYCTU A:[261-286] -----------------------------------------------------TVTDAT--SFLRGPSVLVA-RGDLA--DDWW-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------