@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Wbm0022: (2015-11-27 )
MVEVFLNNATKKIEGEYHQSKETNAPVVLILHHHPQYGGSMDSKMIHSIYTSFIDNNFSALKINFRGVGKSTGTFDKGIGELTDAAIAIDWLQEHNPSNVPIWIVGFSFGAWVAMQLTMRRPEIVGFIALSLPATKYDFSFLSPCPVPGLIIQSSNDTISEESDVTELANRLINSVKSDHMEYHIIGDTNHFLRDKEEEVTQIIDNYVKLRLNSAAISSQMVKKEIRIKEYA

Atome Classification :

(20 SA) -------........-.10.....-.------.--.-20------.....---...30........40-.....-...50........60........70..-..-----------.----------------------..--.80..-......90....---..-..100.......110..-...-..120.----...-....130......-------------------.-------------------------------------------------------------------.-----------------------------------------.-------------------------------------------140.......150.......160.......170.......180.......190.---.-----------..--------.----...200........210...--....220.......230------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) -------MVEVFLNN-ATKKIEGE-Y------H--Q-SK------ETNAP---VVLILHHHPQYGGSM-DSKMI-HSIYTSFIDNNFSALKINFRGVGKSTG-TF-----------D----------------------KG--IGELT-DAAIAIDWLQEH---NP-SNVPIWIVGFSFGAWVA-MQL-TMR-RP----EIV-GFIAL--SLPATK-------------------Y-------------------------------------------------------------------D-----------------------------------------F-------------------------------------------SFLSPCPVPGLIIQSSNDTISEESDVTELANRLINSVKSDHMEYHIIGDTNH-F---L-----------RD--------K----EEEV-TQIIDNYVKLRLNSA--AISSQMVKKEIRIKEYA------
21 HHSearch 91.5541%-118 - C1 -2I3D ? A:[24-238] --------PEVIFNG-PAGRLEGR-Y------Q--P-SK------EKSAP---IAIILHPHPQFGGTM-NNQIV-YQLFYLFQKRGFTTLRFNFRSIGRSQG-EF-----------D----------------------HG--AGELS-DAASALDWVQSL---HP-DSKSCWVAGYSFGAWIG-MQL-LMR-RP----EIE-GFMSI--APQPNT-------------------Y-------------------------------------------------------------------D-----------------------------------------F-------------------------------------------SFLAPCPSSGLIINGDADKVAPEKDVNGLVEK-LKTQKGILITHRTLPGANH-F---F-----------NG--------K----VDEL-MGECEDYLDRRLNGE--LVPEP------------------
1 PsiBlast_PDB 89.7839%-116 - C1 -2I3D ? A:[25-241] ---------EVIFNG-PAGRLEGR-Y------Q--P-SK------EKSAP---IAIILHPHPQFGGTM-NNQIV-YQLFYLFQKRGFTTLRFNFRSIGRSQG-EF-----------D----------------------HG--AGELS-DAASALDWVQSL---HP-DSKSCWVAGYSFGAWIG-MQL-LMR-RP----EIE-GFMSI--APQPNT-------------------Y-------------------------------------------------------------------D-----------------------------------------F-------------------------------------------SFLAPCPSSGLIINGDADKVAPEKDVNGLVEKL-KTQKGILITHRTLPGANH-F---F-----------NG--------K----VDEL-MGECEDYLDRRLNGE--LVPEP------------------
43 Fugue 80.9236%-105 - C1 -2I3D ? A:[24-241] --------PEVIFNG-PAGRLEGR-Y------Q--P-SK------EKSAP---IAIILHPHPQFGG-TMNNQIV-YQLFYLFQKRGFTTLRFNFRSIGRSQG-EF-----------D----------------------HG--AGELS-DAASALDWVQSL---HP-DSKSCWVAGYSFGAWIGMQLLMRRP-EI----EGFMSIAP-----QPNT-------------------Y-------------------------------------------------------------------D-----------------------------------------F-------------------------------------------SFLAPCPSSGLIINGDADKVAPEKDVNGLVEKL-KTQKGILITHRTLPGANH-F---F-----------NG--------K----VDELMGECEDYLDRRLNGEL--VPEP-------------------
42 Fugue 72.8424%-108 - C1 -3TRD ? A:[1-208] --SYVMTNEDFLIQG-PVGQLEVM-I------T--RPKG------IEKSV---TGIICHPHPLHGGTM-NNKVV-TTLAKALDELGLKTVRFNFRGVGKSQG-RY-----------D----------------------NG--VGEVE-DLKAVLRWVEHH---WS--QDDIWLAGFSFGAYIS-AKV-AYD-QK-----VA-QLISV--APPVFY-------------------E-------------------------------------------------------------------G-----------------------------------------F-------------------------------------------ASLTQMASPWLIVQGDQDEVVPFEQVKAFVNQI-----SSPVEFVVMSGASH-F---F-----------HG--------R----LIEL-RELLVRNLA-------------------------------
36 HHSearch 70.0125%-104 - C1 -3TRD ? A:[7-206] --------EDFLIQG-PVGQLEVMIT------R--P-KG------IEKSV---TGIICHPHPLHGGTM-NNKVV-TTLAKALDELGLKTVRFNFRGVGKSQG-RY-----------D----------------------NG--VGEVE-DLKAVLRWVEHH---W--SQDDIWLAGFSFGAYIS-AKV-AYD-Q-----KVA-QLISV--APPVFY-------------------E-------------------------------------------------------------------G-----------------------------------------F-------------------------------------------ASLTQMASPWLIVQGDQDEVVPFEQVKAFVNQ-IS----SPVEFVVMSGASH-F---F-----------HG--------R---------LIELRELLVRNLA---------------------------
2 PsiBlast_PDB 68.8928%-123 - C1 -3TRD ? A:[35-203] -------------------------------------------------------IICHPHPLHGGTM-NNKVV-TTLAKALDELGLKTVRFNFRGVGKSQG-RY-----------D----------------------NG--VGEVE-DLKAVLRWV-EH---HW-SQDDIWLAGFSFGAYIS-AKV-AYD-Q-----KVA-QLISV--APPVFY-------------------E-------------------------------------------------------------------G-----------------------------------------F-------------------------------------------ASLTQMASPWLIVQGDQDEVVPFEQVKAFVNQI-----SSPVEFVVMSGASH-F---F-----------HG--------R----LIEL-RELLVRNLA-------------------------------
44 Fugue 67.9625% -92 - C1 -2FUK - ? A:[3-220] NPLFPTESAALTLDG-PVGPLDVA-V------D--L-PE------PDVAVQPVTAIVCHPLSTEGGSM-HNKVV-TMAARALRELGITVVRFNFRSVGTSAG-SF-----------D----------------------HG--DGEQD-DLRAVAEWVRAQ---RP-TD-TLWLAGFSFGAYVS-LRA-AAA-LE-----PQ-VLISI--APPAGR-------------------W-------------------------------------------------------------------D-----------------------------------------F-------------------------------------------SDVQP-PAQWLVIQGDADEIVDPQAVYDWLET-----LEQQPTLVRMPDTSH-F---F-----------HR--------K----LIDL-RGALQHGVRRWLPAT--P----------------------
24 HHSearch 64.4724% -94 - C1 -2FUK - ? A:[12-217] ---------ALTLDG-PVGPLDVAVD------L--P-EPDV----AVQPV---TAIVCHPLSTEGGSM-HNKVV-TMAARALRELGITVVRFNFRSVGTSAG-SF-----------D----------------------HG--DGEQD-DLRAVAEWVRAQ---R--PTDTLWLAGFSFGAYVS-LRA-AAA-LE-----PQ-VLISI--APPAGR-------------------W-------------------------------------------------------------------D-----------------------------------------F-------------------------------------------SD-VQPPAQWLVIQGDADEIVDPQAVYDWLET-LE----QQPTLVRMPDTSH-F---F-----------HR--------KLIDLRGAL-QHGVRRWLPATP----------------------------
22 HHSearch 62.7319%-110 * C1 *3PFB ? A:[23-265] --------ATITLER-DGLQLVGTRE------E--P-FG-------EIYD---MAIIFHGFTANRNT----SLL-REIANSLRDENIASVRFDFNGHGDSDG-KF-----------ENM--------------------TV--LNEIE-DANAILNYVKTD---P--HVRNIYLVGHAQGGVVA-SML-AGL-YPD---LIK-KVVLL--APAATL-------------------K-------------------------------------------------------------------GDALEGNTQGVTYN----------------------------PDHIPDRLPFKDLTLGGFYLRIAQQLPIY---------------EVSAQFTKPVCLIHGTDDTVVSPNASKKYDQI-Y-----QNSTLHLIEGADH-C---F-----------SD--------SY---QKNA-VNLTTDFLQ-------------------------------
28 HHSearch 61.7718%-106 - C1 -2WTM ? A:[6-250] ------------IDC-DGIKLNAYLD------M--P-KNN-----PEKCP---LCIIIHGFTGHSEER-H---I-VAVQETLNEIGVATLRADMYGHGKSDG-KF-----------EDH--------------------TL--FKWLT-NILAVVDYAKKL---D--FVTDIYMAGHSQGGLSV-MLA-AAM-ERD---IIK-ALIPL--SPAAMIPEIARTGELLGLK------F-------------------------------------------------------------------D-----------------------------------------PENIPDELDAWDGRKLKGNYVRVAQTIRVE--------------DFVDKYTKPVLIVHGDQDEAVPYEASVAFSKQ-Y-----KNCKLVTIPGDTH-C---Y-----------DH--------H----LELV-TEAVKEFMLEQIAK--------------------------
3 PsiBlast_PDB 61.7230%-104 - C1 -2FUK - ? A:[41-200] -------------------------------------------------------IVCHPLSTEGGSM-HNKVV-TMAARALRELGITVVRFNFRSVGTSAG-SF-----------D----------------------HG--DGEQD-DLRAVAEWVRAQ---RP-TDT-LWLAGFSFGAYVS-LRA-AAALEP----QV---LISI--APPAGR-------------------W-------------------------------------------------------------------D-----------------------------------------F-------------------------------------------SDVQP-PAQWLVIQGDADEIVDPQAVYDWLETLEQQPTLVRMP-----DTSH-F---F-----------HR--------K----LIDL-RGALQHGVRRWLPAT--P----------------------
41 HHSearch 57.1117%-117 - C1 -3KSR ? A:[7-244] --------SSIEIPV-GQDELSGTLL------T--P-TG---------MP---GVLFVHGWGGSQHHS-----L-V-RAREAVGLGCICMTFDLRGHEGYAS-MR-----------QSV--------------------TR--AQNLD-DIKAAYDQLASL---PYVDAHSIAVVGLSYGGYLS-ALL-TRE-RP-----VE-WLALR--SPALYKDAHWDQPKVSLNADPDLMDY-------------------------------------------------------------------RRRALAPGDNLA------------------------------L-------------------------------------------AACAQYKGDVLLVEAENDVIVPHPVMRNYADA-FTNA--RSLTSRVIAGADH-A---L-----------SV--------KEH--QQEY-TRALIDWLTEMVVGR-------------------------
37 HHSearch 56.6515% -92 - C1 -3BJR ? A:[28-282] -------------TA-TCAQLTGYLH--------------------TNLP---AIIIVPGGSYTHIPV---AQA-ESLAMAFAGHGYQAFYLEYTLLTDQQP-L------------------------------------G--LAPVL-DLGRAVNLLRQHAAEWHIDPQQITPAGFSVGGHIV-ALY-NDY-WAT---RVA-TELNV--TPAMLK-------------------PNNVVLGYPVI---------------------------------------------------------SPLLGFTWTPTPNELAA-------------------------D-------------------------------------------QHVNSDNQPTFIWTTADDPIVPATNTLAYATA-LATAK-IPYELHVFKHGPH-G---L-----------ALANAQTAWK-----VAHW-LTLALEWLADNR----------------------------
35 HHSearch 54.7315%-112 - C1 -3WI7 DHAA_AGRFC A:[28-302] ----------------FGLQIHTV-E------H-------------GSGA---PIVFLHGNPTSSYL------W-RHIFRRLHG-HGRLLAVDLIGYGQSSK-PD-----------IEY--------------------TL--ENQQR-YVDAWFDAL---------DLRNVTLVLQDYGAAFG-LNW-ASR-NPD---RVR-AVAFF--EPVLRN-------------------IDSVDLSPEFVTRRAKLRQPGEGEIFVQQENRFLTELFPWFFLTPL----------------------A-----------------------------------------PEDLRQYQTPFPTPHSRKAILAGPRNLPVDGEPASTVAFLEQAVNWLNTSDTPKLLLTFKPGFLLTDAILKWSQVT-I-----RNLEIEAAGAGIH-F---V-----------QE--------EQ---PETI-ARLLDAWLTRIA----------------------------
33 HHSearch 54.0018% -91 - C1 -1K8Q LIPG_CANFA A:[29-376] ---------EYEVVTEDGYILGID-R------I--P-YGRKNSENIGRRP---VAFLQHGLLASATNW-ISNLPNNSLAFILADAGYDVWLGNSRGNTWARR-NLYYSPDSVEFWAF----------------------SF--DEMAKYDLPATIDFILKK---T--GQDKLHYVGHSQGTTIG-FIA-FST-NPKLAKRIK-TFYAL--APVATV-------------------KYTETLINKLMLVPSFLFKLIFGNKIFYPHHFFDQFLATEVCSRETVDLLCSNALFIICGFDTMNLNMSRLDVYLSH---------------------------------NPAGTSVQNVLHWSQAVKSGKFQAFDWGSPVQNMMHYHQSMPPYYNLTDMHVPIAVWNGGNDLLADPHDVDLLLSK-LPN----LIYHRKIPPYNH-LDFIW-----------AM--------DA---PQAV-YNEIVSMMGTD-----------------------------
27 HHSearch 53.5515%-114 - C1 -1L7A - CAH_BACSU A:[57-316] --------YRLTYKSFGNARITGWYA------V--P-DK------EGPHP---AIVKYHGYNASYDGE-------IHEMVNWALHGYATFGMLVRGQQRSED-TS-----------ISPHGHALGWMTKGILDKDTY--YY--RGVYL-DAVRALEVISSF---DEVDETRIGVTGGSQGGGLT-IAA-AAL-SD----IPK-AAVAD--YPYLSN-------------------F-------------------------------------------------------------------ERAIDVALEQPYLEINSFFRRNGSPETEVQAMKTLSYFD---IM------------------------------------------NLADRVKVPVLMSIGLIDKVTPPSTVFAAYNH-LE----TKKELKVYRYFGH-E---Y-----------IP---------------AF-QTEKLAFFKQILKG--------------------------
50 Fugue 53.2515%-107 - C1 -1IMJ ABHEB_HUMAN A:[2-209] -------AASVEQRE-GTIQVQGQ-ALFFREAL--P-GS------GQARF---SVLLLHG---IRFSS-ETWQN-LGTLHRLAQAGYRAVAIDLPGLGHSKEAAA-----------P----------------------AP--IGELA-PGSFLAAVVDAL---EL-G--PPVVISPSLSGMYS-LPF-LTA-PG----SQL-PGFVPVAPICTDK-------------------I-------------------------------------------------------------------N-----------------------------------------A-------------------------------------------ANYASVKTPALIVYGDQD------PMGQTSFEHLKQLP--NHRVLIMKGAGHPC---Y-----------LD--------K----PEEW-HTGLLDFLQGL-----------------------------
25 HHSearch 52.8514%-111 - C1 -2JBW DHPON_ARTNI A:[128-369] --------ERHELVV-DGIPMPVYVR------I--P-EG------PGPHP---AVIMLGGLESTKEE------S-FQMENLVLDRGMATATFDGPGQGEMFE-YK-----------R----------------------IA--GDYEK-YTSAVVDLLTKL---EAIRNDAIGVLGRSLGGNYA-LKS-AAC-EP----RLA-ACISW--GGFSDL-------------------D-------------------------------------------------------------------YWDLETPLTKESWKYVSKVDTLEEARLHVHAALE--------TR------------------------------------------DVLSQIACPTYILHGVHDE-VPLSFVDTVLEL-VPA---EHLNLVVEKDGDH-C---C-----------HN--------L----GIRP-RLEMADWLYDVLVAG--KKVAPTMKGWPLEH---------
46 Fugue 51.1514% -88 - C1 -2WTM ? A:[2-251] --------GAMYIDC-DGIKLNAY-L------DMPK-NN------PEKCP---LCIIIHG---FTGHS-EERHI-VAVQETLNEIGVATLRADMYGHGKSDG-KF-----------E----------------------DHTLFKWLT-NILAVVDYAKK----LD-FVTDIYMAGHSQGGLSV-MLA-AAM-ER----DII-KALIP--LSPAAM-------------------I-------------------------------------------------------------------P-----------------------------------------E-------------------------------------------IARTGELLGLKFDPENIPDELDAWDGRKLKGNYVRVAQTIRVEDFVDKYTKP-V---LIVHGDQDEAVPYE--------A----SVAF-SKQYKNCKLVTIPGDTHCYDHHLELVTEAVKEFMLEQIAK
30 HHSearch 50.7813% -94 - C1 -3FCY ? A:[84-344] ---------DLYFTGVRGARIHAKYI------K--P-KT------EGKHP---ALIRFHGYSSNSGDW-------NDKLNYV-AAGFTVVAMDVRGQGGQSQ-DV-----------GGVTGNTLNGHIIRGLDDDADNMLF--RHIFL-DTAQLAGIVMNM---PEVDEDRVGVMGPSQGGGLS-LAC-AAL-EP----RVR-KVVSE--YPFLSD-------------------Y-------------------------------------------------------------------KRVWDLDLAKNAYQEITDYFRLFDPRHERENEVFTKLGYIDVK-------------------------------------------NLAKRIKGDVLMCVGLMDQVCPPSTVFAAYNN-IQ----SKKDIKVYPDYGH-E---P-----------MR--------GF---GDLA-MQFMLELYS-------------------------------