@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Wbm0025: (2015-11-27 )
MSNNNFLLSYACFPNKTRGRYFKEQEDENRSCFQRDRDRIIHSNAFRKLEYKTQVFINYEHDYYRTRLTHSLEVAQIARSIARRLGLDEDITECIALAHDLGHPPFGHTGENALKRAVQDLNLDNEKYEFDHNVQAIRILTYLEQKHADFDGMNLSWEVVEGVAKHNGPLLGRNAVSYTNNQLLLEYNEKYNLKLEEFSSIEAQVASIADDIAYSVHDLDDELRANLVTIEDLLNIPLIGKTFKDVESRYSELPQNKLIHESLSRTIGMMISDVVSQTEKNIEDYKIKSVEDVRSLNKMLVTFSPEVANATKEVKKFNMEKIYRSYKLNRTMNKAKRIVEELFQCFYENPRLLPIEWNKLAHKFQRSVVICDYISGMTDRFAIHEHRRIFDTSYEMTSF

Atome Classification :

(20 SA) --------.........10........20........30........40........50...------....---.60........70........80....-------------.---------.--------.------.----------90....---....100.......110..---------------------.....120------..-....-------------..----130.......140....-...150..--.....160.......170.......180......-----.190-----......---..200-....----.---..210......-.------220.......230...-....240......----.250.......260.......270.......280.......290.......300.......310.......-320.......330.......340.......350.......360.......370.......380.......390.......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) --------MSNNNFLLSYACFPNKTRGRYFKEQEDENRSCFQRDRDRIIHSNAFRKLEYKTQ------VFIN---YEHDYYRTRLTHSLEVAQIARSIARRL-------------G---------L--------D------E----------DITECI---ALAHDLGHPPFGHTGENAL---------------------KRAVQDL-------NL-DNEK-------------YE----FDHNVQAIRILTYLEQK-HADFDGMN--LSWEVVEGVAKHNGPLLGRNAVSYTNNQLLLEYN-----EKY------NLKLEE---FSSIE-AQVA----S---IADDIAYSVHD-L------DDELRANLVTIEDLLN-IPLIGKTFKDVES----RYSELPQNKLIHESLSRTIGMMISDVVSQTEKNIEDYKIKSVEDVRSLNKMLVTFSPEVANATKEVKKFNM-EKIYRSYKLNRTMNKAKRIVEELFQCFYENPRLLPIEWNKLAHKFQRSVVICDYISGMTDRFAIHEHRRIFDTSYEMTSF
127 Fugue 92.9142% -75 - C2 -2DQB ? C:[2-376] RFSREALLELEASRLAPYAQKARDTRGRAHPEPESLYRTPYQKDRDRILHTTAFRRLEYKTQ------VLPG------WAYRTRLTHTLEVAQVSRSIARAL-------------G---------L--------N------E----------DLTEAI---ALSHDLGHPPFGHTGEHVL---------------------NALM--------------QDH-------------GG----FEHNAQALRILTHLEVR-YPGFRGLN--LTYEVLEGIATHEALYEGQ---------------------------------------GTLE-AQVV----D---LSDAIAYAAHD-L------DDGFRAGLLHPEELKE-VELLQALALEE------GLDLRLPELDRRVLVRQLLGYFITAAIEATHRRVEEAGVQSAEAVRRHPSRLAALGEEAEKALKALKAF-LMERFYRHPEVLRERRKAEAVLEGLFAAYTRYPELLPREVQAKIPEEGLERAVCDYIAGMTDRFALEAYRRLSP--------
105 HHSearch 91.0843% -74 - C2 -2DQB ? A:[12-376] ----------EASRLAPYAQKARDTRGRAHPEPESLYRTPYQKDRDRILHTTAFRRLEYKTQ------VLPG---WA--YYRTRLTHTLEVAQVSRSIARAL-------------G---------L--------N------E----------DLTEAI---ALSHDLGHPPFGHTGEHVL---------------------NALMQDH-------G--------------------G----FEHNAQALRILTHLEVR-YPGFRGLN--LTYEVLEGIATHEA---------------------------------------G---QGTLE-AQVV----D---LSDAIAYAAHD-L------DDGFRAGLLHPEELKE-VELLQALALEEGL----DLLRLPE-LDRRVLVRQLLGYFITAAIEATHRRVEEAGVQSAEAVRRHPSRLAALGEEAEKALKALKAFLM-ERFYRHPEVLRERRKAEAVLEGLFAAYTRYPELLPREVQAKIPEEGLERAVCDYIAGMTDRFALEAYRRLSP--------
1 PsiBlast_PDB 90.3041% -76 * C2 *2DQB ? A:[16-374] --------------LAPYAQKARDTRGRAHPEPESLYRTPYQKDRDRILHTTAFRRLEYKTQ------VLPG---WA--YYRTRLTHTLEVAQVSRSIARAL-------------G---------L--------N------E----------DLTEAI---ALSHDLGHPPFGHTGEHVL---------------------NALMQDH-------G--------------------G----FEHNAQALRILTHLEVR-YPGFRGLN--LTYEVLEGIATHEA---------------------------------------G---QGTLE-AQVV----D---LSDAIAYAAHD-L------DDGFRAGLLHPEELKE-VELL-QALALEEGLDLLRLPELDRRVLVRQLL----GYFITAAIEATHRRVEEAGVQSAEAVRRHPSRLAALGEEAEKALKALKAFLM-ERFYRHPEVLRERRKAEAVLEGLFAAYTRYPELLPREVQAKIPEEGLERAVCDYIAGMTDRFALEAYRRLSP--------
22 PsiBlast_CBE 59.4731% -54 - C3 -4XDS DGTP_ECOLI E:[25-291] ---------------------------------EHEILRIFESDRGRIINSPAIRRLQQKTQ------VFPL---ERNAAVRTRLTHSMEVQQVGRYIAKEILSRLKELKLLEAYG---------L--------DELTGPFE----------SIVEMS---CLMHDIGNPPFGHFGEAAINDWFRQRLHPEDAESQPLTDDRCSVAAL-------RLRDGEEPLNELRRKIRQDLCH----FEGNAQGIRLVHTLMR--------MN--LTWAQVGGILKYTRPAWWRGETPETHHYLMKKPGYYLSEEAYIARLRKELNLAL---YSRFPLTWIM----E---AADDISYCVAD-L------EDAVEKRIFTVEQLYH-HLHEAWGQHEKGS----LFSLVVENAWEKSRSLSRSTEDQFFMYLRVNTLNKLVPYAAQRFIDNLPAIFAGTFNHALLEDASECSDLL-KLYKNVAVKHVFSHPDVERLELQGYRVISGLLEIYRPLLSLSLSDFTELVEKERVKRFPIESRLFHKLSTRHRLAYVEAV
26 PsiBlast_CBE 58.5531% -57 - C3 -4X9E DGTP_ECOLI B:[25-291] ---------------------------------EHEILRIFESDRGRIINSPAIRRLQQKTQ------VFP------NAAVRTRLTHSMEVQQVGRYIAKEILSRLKELKLLEAYG---------L--------DELTGPFE----------SIVEMS---CLMHDIGNPPFGHFGEAAINDWFRQRLHPEDAQPLTDD--RCSVAAL-------RLRDGEEPLNELRRKIRQDLCH----FEGNAQGIRLVHTLMR--------MN--LTWAQVGGILKYTRPAWWRGETPETHHYLMKKPGYYLSEEAYIARLRKELNLAL---YSRFPLTWIM----E---AADDISYCVAD-L------EDAVEKRIFTVEQLYH-HLHEAWGQHEKGS----LFSLVVENAWEKSRSRSTEDQFFMYLRVNTLNKLVPYAAQRFIDNLPAIFAGTFNHALLEDASECSDLLKL-YKNVAVKHVFSHPDVERLELQGYRVISGLLEIYRPLLSLSLSDFTELVEKERVKRFPIESRLFHKLSTRHRLAYVEAVSK
25 PsiBlast_CBE 57.7231% -52 - C3 -4XDS DGTP_ECOLI B:[25-291] ---------------------------------EHEILRIFESDRGRIINSPAIRRLQQKTQ------VFPL---E--AAVRTRLTHSMEVQQVGRYIAKEILSRLKELKLLEAYG---------L--------DELTGPFE----------SIVEMS---CLMHDIGNPPFGHFGEAAINDWFRQRLHPEDAESQPLTDDRCSVAAL-------RLRDGEEPLNELRRKIRQDLCH----FEGNAQGIRLVHTLMR--------MN--LTWAQVGGILKYTRPAWWRGETPETHHYLMKKPGYYLSEEAYIARLRKELNLAL---YSRFPLTWIM----E---AADDISYCVAD-L------EDAVEKRIFTVEQLYH-HLHEAWGGSLFSL----VVENAWEKSRSRSTEDQFFMYLRVNTLNKLVPYAAQRFIDNLPAIFAGTFNHALLEDASECSDLLKLYKNV-AVKHVFSHPDVERLELQGYRVISGLLEIYRPLLSLSLSDFTELVEKERVKRFPIESRLFHKLSTRHRLAYVEAVSKLPSD
21 PsiBlast_CBE 57.6831% -54 - C3 -4XDS DGTP_ECOLI F:[25-291] ---------------------------------EHEILRIFESDRGRIINSPAIRRLQQKTQ------VFPL---E--AAVRTRLTHSMEVQQVGRYIAKEILSRLKELKLLEAYG---------L--------DELTGPFE----------SIVEMS---CLMHDIGNPPFGHFGEAAINDWFRQRLHPEDAESQPLTDDRCSVAAL-------RLRDGEEPLNELRRKIRQDLCH----FEGNAQGIRLVHTLMR--------MN--LTWAQVGGILKYTRPAWWRGETPETHHYLMKKPGYYLSEEAYIARLRKELNLAL---YSRFPLTWIM----E---AADDISYCVAD-L------EDAVEKRIFTVEQLYH-HLHEAWGSLFSLV----VENAWEKSRSSRSTEDQFFMYLRVNTLNKLVPYAAQRFIDNLPAIFAGTFNHALLEDASECSDLLKLYKNV-AVKHVFSHPDVERLELQGYRVISGLLEIYRPLLSLSLSDFTELVEKERVKRFPIESRLFHKLSTRHRLAYVEAVSKLPSD
3 PsiBlast_PDB 56.2431% -54 - C3 -4XDS DGTP_ECOLI A:[25-291] ---------------------------------EHEILRIFESDRGRIINSPAIRRLQQKTQ------VFPL---E--AAVRTRLTHSMEVQQVGRYIAKEILSRLKELKLLEAYG---------L--------DELTGPFE----------SIVEMS---CLMHDIGNPPFGHFGEAAINDWFRQRLHPEDAESQPLTDDRCSVAAL-------RLRDGEEPLNELRRKIRQDLCH----FEGNAQGIRLVHTLMR--------MN--LTWAQVGGILKYTRPAWWRGETPETHHYLMKKPGYYLSEEAYIARLRKELNLAL---YSRFPLTWIM----E---AADDISYCVAD-L------EDAVEKRIFTVEQLYH-HLHEAWGGSLFSL----VVENAWEKSRRSTEDQFFMYLRVNTLNKLVPYAAQRFIDNLPAIFAGTFNHALLEDASECSDLLKLYKNVA-VKHVFSHPDVERLELQGYRVISGLLEIYRPLLSLSLSDFTELVEKERVKRFPIESRLFHKLSTRHRLAYVEAVSKLPSDS
107 HHSearch 50.6014% -52 - C2 -2Q14 ? A:[24-246] --------------------------------------------LYDIVRHPLLQRLTRIKQ------VGLSSVVYPGA-QHTRFQHSLGAFYLMSEAITQL-------------T---------SKGNFIFDSE------A----------EAVQAA---ILLHDIGHGPFSHVLEDTI---------------------VQ---------------------------------G----VSHEEISLMLMERMNKE-M----NG---QLSLAIQIFKDE-Y-------------------------------------------PKRFL-HQLV----SGQLDMDRLDYLRRDSF------YTGVTEGNIGSARIIKMLD-------------------------V-------AD---DRLV--IE--------S---------KGI-----YSIENFLTARRLMY-WQVYLHKTSVAYERMLISTLLRAKELASQGVELFASPALHFFLYNDINHTEFHNNPDCLENFIQLDDNDIWTALKVWSNH
4 PsiBlast_PDB 49.6628% -48 - C3 -3BG2 - ? A:[23-271] --------------------------------EQDDTRLGFEVDYDRIIFSAPFRSLQDKTQ------VIP------TDFVHTRLTHSLEVSVVGRSLGRMV-------------GKKLLEKYPHL--------E------QVYGYKFNDFGAIVAAA---ALAHDIGNPPFGHSGEKAI---------------------GEFFKNGYGKRYKDSL-TAKE-------------YQDLIKFEGNANGFKVLS--QSK-PGAQGGLR--LSYATLGAFMKYPKESL-----------------------KY------GFFQSERALFEDVA-QELGLLKR-------DVSWSRHP-LAYLVEAADDICYTIIDFEDGIN-LGLIPEYNALQET----SDRVSYLRALAIGTLINESVDTFMKYEEEILAGTFDQSLIDKSNYQAQITDIINLSIERIYNSREVIEKEI-AGYEILSTLLEARCRALDNNDTHYNQLIQQLLAKSLYENLIQICAEVSTMTDGKALRNYKKIKGL---------------
106 HHSearch 46.9725% -50 * C5 *2HEK ? A:[17-187] ------------------------------------------EAGLRLIDSFPFQRLRYVKQ------LGLAYLVFPSA-QHTRFEHSLGVYHITERICESL-------------K---------VK-------E------K----------ELVKLA---GLLHDLGHPPFSHTTEVLL---------------------PR---------------------------------E----RSHEDFTERVIKETEIYEILKQ-DYSHEDIERLVRITLGKPED--------------------------------------E---EEKLL-SEII----TGEFGSDRMDYLRRDAY------FCGVSYGFFDYDRLIS-TLRVYENKVVVDE----SGLRALENFLISRYFMYVQVYFHKVVRILSIHLVEFLKKLISQEDFTDINNFLRLNDAFVISELFKRKAFR-EDFERIFQRKHFKTLLSTENYEKFSETKERLLEKFPQEKVRFDEVEKEVYGGNIYVLSSEGLKKAHELSPLIASLKPIKL
91 PsiBlast_CBE 44.6531% -73 - C3 -4TO5 SAMH1_HUMAN B:[22-103] ----------------------------------------------RIIDTPQFQRLRYIKQLGGGYYVFPG---ASHN----RFEHSLGVGYLAGCLVHAL-------------GEKQPELQ--I--------S------E----------RDVLCVQIAGLCRNLGHGPFSHMFDGRF---------------------IPLARPE-------VK-WTHE-------------QG----SVMMFEHLINSNGIKPV-MEQYGLIP--EEDICFIKEQIVGPLELWPYKGRPENKSFLYEIV-----SNK------RNGIDV---DKWDY-FARD----C---HHLGIQNNFDY-K------RFIKFARVCEVDNELR-ICARDKEVGNLYD----MFHTRNSLHRRAYQHKVGNIIDTMITDAFLKADDYIEITGAGGKKYRISTAIDDMEAYTKLTDNIFLEILY-STDPKLKDAREILKQIEYRNLFKYVGETQPTGQIKIKREDYESLPKEVASAKPKVLLDVKLKAEDFIVDVINMDYGMQEK
81 PsiBlast_CBE 44.5431% -71 - C3 -4ZWG ? D:[22-103] ----------------------------------------------RIIDTPQFQRLRYIKQLGGGYYVFPG---ASHN----RFEHSLGVGYLAGCLVHAL-------------GEKQPELQ--I--------S------E----------RDVLCVQIAGLCRNLGHGPFSHMFDGRF---------------------IPLARPE-------VK-WTHE-------------QG----SVMMFEHLINSNGIKPV-MEQYGLIP--EEDICFIKEQIVGPLELWPYKGRPENKSFLYEIV-----SNK------RNGIDV---DKWDY-FARD----C---HHLGIQNNFDY-K------RFIKFARVCEVDNELR-ICARDKEVGNLYD----MFHTRNSLHRRAYQHKVGNIIDTMITDAFLKADDYIEITGAGGKKYRISTAIDDMEAYTKLTDNIFLEILY-STDPKLKDAREILKQIEYRNLFKYVGETQIKREDYESLPKEVASAKPKVLLDVKLKAEDFIVDVINMDYGMQEKNPIDHV
5 PsiBlast_PDB 44.4740% -52 - C3 -2HEK ? A:[21-101] ----------------------------------------------RLIDSFPFQRLRYVKQLGLAYLVFPS---AQH----TRFEHSLGVYHITERICESL-------------K---------V--------K------EK---------ELVKLA---GLLHDLGHPPFSHTTEVLL---------------------PRERSHE-------DF-TERV-------------IK----ETEIYEILKQDYSHEDI-ERLVRITL--GKPEDEEEKLLSEIITGEFGSDRMDYLRRDAYFC-----GVS------YGFFDY---DRLIS-TLRV----Y---ENKVVVDESGL-R------ALENFLISRYFMYVQV-YFHKVVRILSIHL----VEFLKKLISQEDFTDINNFLRLNDAFVISELFKRKAFREDFERIFQRKHFKTLLSTENYEKFSETKERLLE-KFPQEKVRFDEVEKEVYGGNIYVLSSEGLKKAHELSPLIASLKPIKLYRIYVDRQLWEKARSELK---------------
35 PsiBlast_CBE 43.8133% -74 - C3 -4RXS SAMH1_HUMAN B:[47-128] ----------------------------------------------RIIDTPQFQRLRYIKQLGGGYYVFPG---ASHN----RFEHSLGVGYLAGCLVHAL-------------GEKQPELQ--I--------S------E----------RDVLCVQIAGLCHDLGHGPFSHMFDGRF---------------------IPLARPE-------VK-WTHE-------------QG----SVMMFEHLINSNGIKPV-MEQYGLIP--EEDIYFIKEQIVGPLELWPYKGRPENKSFLYEIV-----SNK------RNGIDV---DKWDY-FARD----C---HHLGIQNNFDY-K------RFIKFARVCEVDNELR-ICARDKEVGNLYD----MFHTRNSLHRRAYQHKVGNIIDTMITDAFLKADDYIEITGAGGKKYRISTAIDDMEAYTKLTDNIFLEILY-STDPKLKDAREILKQIEYRNLFKYVGETQPTGQIKIKREDYESLPKEVASAKPKVLLDVKLKAEDFIVDVINMDYGMQEK
89 PsiBlast_CBE 43.7831% -68 - C3 -4TO5 D:[22-103] ----------------------------------------------RIIDTPQFQRLRYIKQLGGGYYVFPG---ASHN----RFEHSLGVGYLAGCLVHAL-------------GEKQPELQ--I--------S------E----------RDVLCVQIAGLCRNLGHGPFSHMFDGRF---------------------IPLARPE-------VK-WTHE-------------QG----SVMMFEHLINSNGIKPV-MEQYGLIP--EEDICFIKEQIVGPLLWPYKGRPENKSFLYEIVS-----NKR------NGIDVD---KWDYF-ARDC----H---HLGIQNNFDYK-R------FIKFARVCEVDNELRI-CARDKEVGNLYDM----FHTRNSLHRRAYQHKVGNIIDTMITDAFLKADDYIEITGAGGKKYRISTAIDDMEAYTKLTDNIFLEILYS-TDPKLKDAREILKQIEYRNLFKYVGETQPTGQIKIKREDYESLPKEVASAKPKVLLDVKLKAEDFIVDVINMDYGMQEKN
41 PsiBlast_CBE 43.7133% -72 - C3 -4RXO SAMH1_HUMAN B:[47-128] ----------------------------------------------RIIDTPQFQRLRYIKQLGGGYYVFPG---ASHN----RFEHSLGVGYLAGCLVHAL-------------GEKQPELQ--I--------S------E----------RDVLCVQIAGLCHDLGHGPFSHMFDGRF---------------------IPLARPE-------VK-WTHE-------------QG----SVMMFEHLINSNGIKPV-MEQYGLIP--EEDIYFIKEQIVGPLESLWPYKGRPENKSFLYEI-----VSN------KRNGID---VDKWD-YFAR----D---CHHLGIQNNFD-Y------KRFIKFARVCEVDNEL-RICARDKEVGNLY----DMFHTRNSLHRRAYQHKVGNIIDTMITDAFLKADDYIEITGAGGKKYRISTAIDDMEAYTKLTDNIFLEIL-YSTDPKLKDAREILKQIEYRNLFKYVGETQPTGQIKIKREDYESLPKEVASAKPKVLLDVKLKAEDFIVDVINMDHVSFY