@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Wbm0028: (2015-11-27 )
MLKTFILIMNMENEKAHITKVKLPIFLDYQSTTKVDPRVLEMMIPYFSEFSNAHSRSHSFGWAAEEVVEKARRHIADLVNADSKEIIFTSGATESNNMAIKGVAHFYKNKGDHIITVCTEHKCVLDSCRHLENEGFKVTYLPVKRNGIIDLSKLEEAITDRTILVSVMMVNNEIGVIQPVKEIGAICRRHNVFFHTDAAQSFGKVPVDVNGMNIDLMSLTSHKVYGPMGIGALYVRRKSPRVRLTPLISGGGQERGMRSGTVPTPLAVGFGEAARIAKEEMKKEASKLEELRDILYNKIKEAFPDVVLNGDYNNRIPGNLNLSFPYVEGESLIMAIKDLAVSSGSACTSASLEPSYVIRSLNSGYDLEHSSIRFGLGRFTTKDEILYAADLIAKNVGRLREMSPLWEMVQEGIDLNTVKWDSH

Atome Classification :

(25 SA) .........10........20........30........40.......---.50........60........70........80........90........100..-...-------..110-.--------.---......120.......130.-.......140.-..-....150.......--160.......170.......180.......--190--------.----------........200.......210.......220.......230......----.240.----.......250.......260.......270.......280.......290.....---..300...--....310.---.-.....--------.320..--...--..330--....--.--..-340-.........-350-.-......360.......370.......380.......390.......400.......410.......420.
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MLKTFILIMNMENEKAHITKVKLPIFLDYQSTTKVDPRVLEMMIPYFS---EFSNAHSRSHSFGWAAEEVVEKARRHIADLVNADSKEIIFTSGATESNNMAIKGVA-HFY-------KNK-G-D--------H---IITVCTEHKCVLDSCRHL-E-NEGFKVTYLPV-KR-NGIIDLSKLEEAIT--DRTILVSVMMVNNEIGVIQPVKEIGAICRR--H----------N----------VFFHTDAAQSFGKVPVDVNGMNIDLMSLTSHKVYGPMGIGALYVRRK----SPR-V----RLTPLISGGGQERGMRSGTVPTPLAVGFGEAARIAKEEMKKEASKLEELRDILYN---KIKEAFPD--VVLNG-DY---N-NRIPG--------NLNLSF--PYV--EGESL--IMAI--K--DL-A---VSSGSACTS-ASL-E-PSYVIRSLNSGYDLEHSSIRFGLGRFTTKDEILYAADLIAKNVGRLREMSPLWEMVQEGIDLNTVKWDSH
1 PsiBlast_PDB 96.3461% -97 - C3 -3LVJ ISCS_ECO57 A:[20-409] --------------------MKLPIYLDYSATTPVDPRVAEKMMQFMTMDGTFGNPASRSHRFGWQAEEAVDIARNQIADLVGADPREIVFTSGATESDNLAIKGAA-NFY-------QKK-G-K--------H---IITSKTEHKAVLDTCRQL-E-REGFEVTYLAP-QR-NGIIDLKELEAAMR--DDTILVSIMHVNNEIGVVQDIAAIGEMCRA--R----------G----------IIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRK-----PR-V----RIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMERLRGLRNRLWN---GIKD-IEE--VYLNG-DL---E-HGAPN--------ILNVSF--NYV--EGESL--IMAL--K--DL-A---VSSG-------SL-E-PSYVLRALGLNDELAHSSIRFSLGRFTTEEEIDYTIELVRKSIGRLRDLSPLWEMY--------------
2 PsiBlast_PDB 95.5661% -95 - C3 -3LVK ISCS_ECO57 A:[20-411] --------------------MKLPIYLDYSATTPVDPRVAEKMMQFMTMDGTFGNPASRSHRFGWQAEEAVDIARNQIADLVGADPREIVFTSGATESDNLAIKGAA-NFY-------QKK-G-K--------H---IITSKTEHKAVLDTCRQL-E-REGFEVTYLAP-QR-NGIIDLKELEAAMR--DDTILVSIMHVNNEIGVVQDIAAIGEMCRA--R----------G----------IIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRK-----PR-V----RIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMERLRGLRNRLWN---GIKD-IEE--VYLNG-DL---E-HGAPN--------ILNVSF--NYV--EGESL--IMAL--K--DL-A---VSSGSAC-----L-E-PSYVLRALGLNDELAHSSIRFSLGRFTTEEEIDYTIELVRKSIGRLRDLSPLWEMYKQ------------
21 PsiBlast_CBE 94.5761% -95 - C3 -3LVJ ISCS_ECO57 B:[20-411] --------------------MKLPIYLDYSATTPVDPRVAEKMMQFMTMDGTFGNPASRSHRFGWQAEEAVDIARNQIADLVGADPREIVFTSGATESDNLAIKGAA-NFY-------QKK-G-K--------H---IITSKTEHKAVLDTCRQL-E-REGFEVTYLAP-QR-NGIIDLKELEAAMR--DDTILVSIMHVNNEIGVVQDIAAIGEMCRA--R----------G----------IIYHVDATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRK-----PR-V----RIEAQMHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMATEMERLRGLRNRLWN---GIKD-IEE--VYLNG-DL---E-HGAPN--------ILNVSF--NYV--EGESL--IMAL--K--DL-A---VSSGSAC-----L-E-PSYVLRALGLNDELAHSSIRFSLGRFTTEEEIDYTIELVRKSIGRLRDLSPLWEMYKQ------------
11 PsiBlast_PDB 83.1731% -87 - C3 -3GZD SCLY_HUMAN C:[27-438] ------------------------VYMDYNATTPLEPEVIQAMTKAMW---EAWGNPSSPYSAGRKAKDIINAARESLAKMIGGKPQDIIFTSGGTESNNLVIHSVVKHFH-------ANQ-T-SGAKP----H---FITSSVEHDSIRLPLEHLVE-EQVAAVTFVPVSKV-SGQTEVDDILAAVR--PTTRLVTIMLANNETGIVMPVPEISQRIKA--L----------NQERVAAGLPPILVHTDAAQALGKQRVDVEDLGVDFLTIVGHKFYGPR-IGALYIRGL----GEF-T----PLYPMLFGGGQERNFRPGTENTPMIAGLGKAAELVTQNCEAYEAHMRDVRDYLEE---RLEAEFGQKRIHLNS-QFPG-T-QRLPN--------TCNFSIRGPRL--QGHVV--LAQC--R--VL-M---ASVGAAC-----D-Q-PSPVLLSYGVPFDVARNALRLSVGRSTTRAEVDLVVQDLKQAVAQLED----------------------
29 PsiBlast_CBE 82.7931% -85 - C3 -3GZC SCLY_HUMAN B:[27-438] ------------------------VYMDYNATTPLEPEVIQAMTKAMW---EAWGNPSSPYSAGRKAKDIINAARESLAKMIGGKPQDIIFTSGGTESNNLVIHSVVKHFH-------ANQ-T--GAKP----H---FITSSVEHDSIRLPLEHLVE-EQVAAVTFVPVSKV-SGQTEVDDILAAVR--PTTRLVTIMLANNETGIVMPVPEISQRIKA--L----------NQERVAAGLPPILVHTDAAQALGKQRVDVEDLGVDFLTIVGHKFYGPR-IGALYIRGL----GEF-T----PLYPMLFGGGQERNFRPGTENTPMIAGLGKAAELVTQNCEAYEAHMRDVRDYLEE---RLEAEFGQKRIHLNS-QFPG-T-QRLPN--------TCNFSIRGPRL--QGHVV--LAQC--R--VL-M---ASVGAACHSDHGD-Q-PSPVLLSYGVPFDVARNALRLSVGRSTTRAEVDLVVQDLKQAVAQLED----------------------
10 PsiBlast_PDB 82.6431% -88 - C3 -3GZC SCLY_HUMAN A:[27-439] ------------------------VYMDYNATTPLEPEVIQAMTKAMW---EAWGNPSSPYSAGRKAKDIINAARESLAKMIGGKPQDIIFTSGGTESNNLVIHSVVKHFH-------ANQ-T--GAKP----H---FITSSVEHDSIRLPLEHLVE-EQVAAVTFVPVSKV-SGQTEVDDILAAVR--PTTRLVTIMLANNETGIVMPVPEISQRIKA--L----------NQERVAAGLPPILVHTDAAQALGKQRVDVEDLGVDFLTIVGHKFYGPR-IGALYIRGL----GEF-T----PLYPMLFGGGQERNFRPGTENTPMIAGLGKAAELVTQNCEAYEAHMRDVRDYLEE---RLEAEFGQKRIHLNS-QFPG-T-QRLPN--------TCNFSIRGPRL--QGHVV--LAQC--R--VL-M---ASVGAACHSDHGD-Q-PSPVLLSYGVPFDVARNALRLSVGRSTTRAEVDLVVQDLKQAVAQLEDQ---------------------
4 PsiBlast_PDB 82.2040% -87 - C3 -4EB7 ISCS2_ARCFU A:[3-380] -------------------------YFDYTSAKPVDERILEAMLPYMT---ESFGNPSSVHSYGFKAREAVQEAREKVAKLVNGGGGTVVFTSGATEANNLAIIGYA-MRN-------ARK-G-K--------H---ILVSAVEHMSVINPAKFL-Q-KQGFEVEYIPV-GK-YGEVDVSFIDQKLR--DDTILVSVQHANNEIGTIQPVEEISEVL-A--G----------K----------AALHIDATASVGQIEVDVEKIGADMLTISSNDIYGPKGVGALWIRKE----A--------KLQPVILGGGQENGLRSGSENVPSIVGFGKAAEITAMEWREEAERLRRLRDRIIDNVLKIEESY------LNG-HP---E-KRLPN--------NVNVRF--SYI--EGESI--VLSL-----DM-AGIQASTGSACSS--TL-Q-PSHVLMACGLKHEEAHGTLLLTLGRYNTDEDVDRLLEVLPGVIERLRSMSPLY-----------------
3 PsiBlast_PDB 81.7340% -86 - C3 -4EB5 ISCS2_ARCFU A:[3-380] -------------------------YFDYTSAKPVDERILEAMLPYMT---ESFGNPSSVHSYGFKAREAVQEAREKVAKLVNGGGGTVVFTSGATEANNLAIIGYA-MRN-------ARK-G-K--------H---ILVSAVEHMSVINPAKFL-Q-KQGFEVEYIPV-GK-YGEVDVSFIDQKLR--DDTILVSVQHANNEIGTIQPVEEISEVL-A--G----------K----------AALHIDATASVGQIEVDVEKIGADMLTISSNDIYGPKGVGALWIRKE----A--------KLQPVILGGGQENGLRSGSENVPSIVGFGKAAEITAMEWREEAERLRRLRDRIIDNVLKIEESY------LNG-HP---E-KRLPN--------NVNVRF--SYI--EGESI--VLSL-----DM-AGIQASTGSACSS-KTL-Q-PSHVLMACGLKHEEAHGTLLLTLGRYNTDEDVDRLLEVLPGVIERLRSMSPLY-----------------
5 PsiBlast_PDB 81.6340% -87 - C3 -4HVK ISCS2_ARCFU A:[3-378] -------------------------YFDYTSAKPVDERILEAMLPYMT---ESFGNPSSVHSYGFKAREAVQEAREKVAKLVNGGGGTVVFTSGATEANNLAIIGYA-MRN-------ARK-G-K--------H---ILVSAVEHMSVINPAKFL-Q-KQGFEVEYIPV-GK-YGEVDVSFIDQKLR--DDTILVSVQHANNEIGTIQPVEEISEVL-A--G----------K----------AALHIDATASVGQIEVDVEKIGADMLTISSNDIYGPKGVGALWIRKE----A--------KLQPVILGGGQENGLRSGSENVPSIVGFGKAAEITAMEWREEAERLRRLRDRIIDNVLKIEESY------LNG-HP---E-KRLPN--------NVNVRF--SYI--EGESI--VLSL-----DM-AGIQASTG----------Q-PSHVLMACGLKHEEAHGTLLLTLGRYNTDEDVDRLLEVLPGVIERLRSMSP-------------------
89 HHSearch 81.2837% -91 * C3 *1EG5 ? A:[2-376] -----------------------RVYFDNNATTRVDDRVLEEMIVFYRE--KYGNPNSA-HGMGIEANLHMEKAREKVAKVLGVSPSEIFFTSCATESINWILKTVA-ETF--------EK-RKR--------T---IITTPIEHKAVLETMKYL-S-MKGFKVKYVPV-DS-RGVVKLEELEKLVD--EDTFLVSIMAANNEVGTIQPVEDVTRIVKKKNK----------E----------TLVHVDAVQTIGKIPFSLEKLEVDYASFSAHKFHGPKGVGITYIRKG-----VP-------IRPLIHGGGQERGLRSGTQNVPGIVGAARAMEIAVEELSEAAKHMEKLRSKLVS---GLMN-L-G--AHIIT-PL---E-ISLPN--------TLSVSF--PNI--RGSTL--QNLL--SGYGI-Y---VST---------------HVLDAMGVDRRIAQGAIRISLCKYNTEEEVDYFLKKIEEILSFL------------------------
22 PsiBlast_CBE 80.7340% -88 - C3 -4EB7 ISCS2_ARCFU B:[3-378] -------------------------YFDYTSAKPVDERILEAMLPYMT---ESFGNPSSVHSYGFKAREAVQEAREKVAKLVNGGGGTVVFTSGATEANNLAIIGYA-MRN-------ARK-G-K--------H---ILVSAVEHMSVINPAKFL-Q-KQGFEVEYIPV-GK-YGEVDVSFIDQKLR--DDTILVSVQHANNEIGTIQPVEEISEVL-A--G----------K----------AALHIDATASVGQIEVDVEKIGADMLTISSNDIYGPKGVGALWIRKE----A--------KLQPVILGGGQENGLRSGSENVPSIVGFGKAAEITAMEWREEAERLRRLRDRIIDNVLKIEESY------LNG-HP---E-KRLPN--------NVNVRF--SYI--EGESI--VLSL-----DM-AGIQASTGSACSS-KTL-Q-PSHVLMACGLKHEEAHGTLLLTLGRYNTDEDVDRLLEVLPGVIERLRSMSP-------------------
77 Fugue 80.0435% -88 - C3 -1ECX ? A:[1-376] ----------------------MRVYFDNNATTRVDDRVLEEMIVFYR---EKYGNPNSAHGMGIEANLHMEKAREKVAKVLGVSPSEIFFTSCATESINWILKTVA-ETF-------EKR-K-R--------T---IITTPIEHKAVLETMKYL-S-MKGFKVKYVPV-DS-RGVVKLEELEKLVD--EDTFLVSIMAANNEVGTIQPVEDVTRIVKK--K----------NKE--------TLVHVDAVQTIGKIPFSLEKLEVDYASFSAHKFHGPKGVGITYIRKG--------V----PIRPLIHGGGQERGLRSGTQNVPGIVGAARAMEIAVEELSEAAKHMEKLRSKLVS---GLMN--LG--AHIIT-PL---E-ISLPN--------TLSVSF--PNI--RGSTL--QNLL--S--GY-G---IYV-------------STHVLDAMGVDRRIAQGAIRISLCKYNTEEEVDYFLKKIEEILSFL------------------------
23 PsiBlast_CBE 79.4540% -86 - C3 -4EB5 ISCS2_ARCFU B:[3-378] -------------------------YFDYTSAKPVDERILEAMLPYMT---ESFGNPSSVHSYGFKAREAVQEAREKVAKLVNGGGGTVVFTSGATEANNLAIIGYA-MRN-------ARK-G-K--------H---ILVSAVEHMSVINPAKFL-Q-KQGFEVEYIPV-GK-YGEVDVSFIDQKLR--DDTILVSVQHANNEIGTIQPVEEISEVL-A--G----------K----------AALHIDATASVGQIEVDVEKIGADMLTISSNDIYGPKGVGALWIRKE----A--------KLQPVILGGGQENGLRSGSENVPSIVGFGKAAEITAMEWREEAERLRRLRDRIIDNVLKIEESY------LNG-HP---E-KRLPN--------NVNVRF--SYI--EGESI--VLSL-----DM-AGIQASTGSACSS-KTL-Q-PSHVLMACGLKHEEAHGTLLLTLGRYNTDEDVDRLLEVLPGVIERLRSMSP-------------------
26 PsiBlast_CBE 79.3836% -91 - C3 -4ISY ISCSL_MYCTU D:[14-385] -------------------------YLDHAATTPMHPAAIEAMAAVQR---TIGNASSL-HTSGRSARRRIEEARELIADKLGARPSEVIFTAGGTESDNLAVKGIY-WAR-------RDA-E-P--------HRRRIVTTEVEHHAVLDSVNWLVE-HEGAHVTWLPT-AA-DGSVSATALREALQSHDDVALVSVMWANNEVGTILPIAEMSVVAME--F----------G----------VPMHSDAIQAVGQLPLDFGASGLSAMSVAGHKFGGPPGVGALLLRRD--------V----TCVPLMHGGGQERDIRSGTPDVASAVGMATAAQIAVDGLEENSARLRLLRDRLVE---GVLAEIDD--VCLNGADD---P-MRLAG--------NAHFTF--RGC--EGDAL--LMLLDAN--GI-E---CSTGS-----------PSHVLIAMGVDAASARGSLRLSLGHTSVEADVDAALEVLPGAVARARRAALAAA----------------
27 PsiBlast_CBE 79.3736% -87 - C3 -4ISY ISCSL_MYCTU C:[14-385] -------------------------YLDHAATTPMHPAAIEAMAAVQR---TIGNASSL-HTSGRSARRRIEEARELIADKLGARPSEVIFTAGGTESDNLAVKGIY-WAR-------RDA-E-P--------HRRRIVTTEVEHHAVLDSVNWLVE-HEGAHVTWLPT-AA-DGSVSATALREALQSHDDVALVSVMWANNEVGTILPIAEMSVVAME--F----------G----------VPMHSDAIQAVGQLPLDFGASGLSAMSVAGHKFGGPPGVGALLLRRD--------V----TCVPLMHGGGQERDIRSGTPDVASAVGMATAAQIAVDGLEENSARLRLLRDRLVE---GVLAEIDD--VCLNGADD---P-MRLAG--------NAHFTF--RGC--EGDAL--LMLLDAN--GI-E---CSTGSA----------PSHVLIAMGVDAASARGSLRLSLGHTSVEADVDAALEVLPGAVARARRAALAAAG---------------
12 PsiBlast_PDB 78.1931% -94 - C3 -3A9X SCLY_RAT A:[20-421] ------------------------VYMDYNATTPLEPEVIQAVTEAMK---EAWGNPSSSYVAGRKAKDIINTARASLAKMIGGKPQDIIFTSGGTESNNLVIHSTV-RCF-------HEQ-Q-TLQGEGTRPH---FITCTVEHDSIRLPLEHLVE-DQVAEVTFVPVSKV-NGQVEVEDILAAVR--PTTCLVTIMLANNETGVIMPISEISRRIKA--L----------NQIRAASGLPRVLVHTDAAQALGKRRVDVEDLGVDFLTIVGHKFYGPR-IGALYVRGV----GKL-T----PLYPMLFGGGQERNFRPGTENTPMIAGLGKAADLVSENCETYEAHMRDIRDYLEE---RLEAEFGK--RI----HL---N-SRFPGVERLPNTCNFSIQG--SQL--RGYMV--LAQC--Q--TL-L---ASVGA---------------------PVDVARNAVRLSVGRSTTRAEV----DLIVQDLKQAVNQLEGPV----------------
24 PsiBlast_CBE 78.0242% -88 - C3 -3VAX ? B:[23-374] -------------------------YLDAAATTRVDQRVADIVLHWMTA--EFGNAGSR-HEYGIRAKRGVERAREYLASTVSAEPDELIFTSGATESNNIALLGLA-PYG-------ERT-G-RR-------H---IITSAIEHKAVLEPLEHL-A-GRGFEVDFLTP-GP-SGRISVEGVMERLR--PDTLLVSLMHVNNETGVIQPVAELAQQLRA--T----------P----------TYLHVDAAQGYGKVPGDLT-TPIDMISISGHKIGAPKGVGALVTRRREEMDDER-V----PLEPIMFGGGQERKLRPGTLPVPLIMGLAEAAKIFEAEHAQWQVAAQDLRSRLLA---GL--ASTS--FQVNG-DQ---D-HVVPH--------ILNLSF--EDV--DAEAF--LVTL--K--DLVA---VATGSASTS-ASF-T-PSHVLRAMGLPEEAASKSLRFSWTPG--------------------------------------------
9 PsiBlast_PDB 78.0236% -90 - C3 -4ISY ISCSL_MYCTU A:[14-385] -------------------------YLDHAATTPMHPAAIEAMAAVQR---TIGNASSL-HTSGRSARRRIEEARELIADKLGARPSEVIFTAGGTESDNLAVKGIY-WAR-------RDA-E-P--------HRRRIVTTEVEHHAVLDSVNWLVE-HEGAHVTWLPT-AA-DGSVSATALREALQSHDDVALVSVMWANNEVGTILPIAEMSVVAME--F----------G----------VPMHSDAIQAVGQLPLDFGASGLSAMSVAGHKFGGPPGVGALLLRRD--------V----TCVPLMHGGGQERDIRSGTPDVASAVGMATAAQIAVDGLEENSARLRLLRDRLVE---GVLAEIDD--VCLNGADD---P-MRLAG--------NAHFTF--RGC--EGDAL--LMLLDAN--GI-E---CSTGS-----------PSHVLIAMGVDAASARGSLRLSLGHTSVEADVDAALEVLPGAVARARRAALA------------------
25 PsiBlast_CBE 77.8236% -88 - C3 -1ECX ? B:[3-364] ------------------------VYFDNNATTRVDDRVLEEMIVFYR---EKYGNPNSAHGMGIEANLHMEKAREKVAKVLGVSPSEIFFTSCATESINWILKTVA-ETF-------EKR-K-R--------T---IITTPIEHKAVLETMKYL-S-MKGFKVKYVPV-DS-RGVVKLEELEKLVD--EDTFLVSIMAANNEVGTIQPVEDVTRIVKK--K----------NKE--------TLVHVDAVQTIGKIPFSLEKLEVDYASFSAHKFHGPKGVGITYIRKG----VP--------IRPLIHGGGQERGLRSGTQNVPGIVGAARAMEIAVEELSEAAKHMEKLRSKLVS---GLMNLGAH--IITPL-EI---S---LPN--------TLSVSF--PNI--RGSTLQNLLSG--Y--GI-Y---VST--------------RHVLDAMGVDRRIAQGAIRISLCKYNTEEEVDYFLKKIEEILSFL------------------------
31 PsiBlast_CBE 77.4031% -91 - C3 -3A9Y SCLY_RAT B:[20-421] ------------------------VYMDYNATTPLEPEVIQAVTEAMK---EAWGNPSSSYVAGRKAKDIINTARASLAKMIGGKPQDIIFTSGGTESNNLVIHSTV-RCF-------HEQ-Q--TRP-----H---FITCTVEHDSIRLPLEHLVE-DQVAEVTFVPVSKV-NGQVEVEDILAAVR--PTTCLVTIMLANNETGVIMPISEISRRIKA--L----------NQIRAASGLPRVLVHTDAAQALGKRRVDVEDLGVDFLTIVGHKFYGPR-IGALYVRGV----GKL-T----PLYPMLFGGGQERNFRPGTENTPMIAGLGKAADLVSENCETYEAHMRDIRDYLEE---RLEAEFGK--RI----HL---N-SRFPGVERLPNTCNFSIQG--SQL--RGYMV--LAQC--Q--TL-L---ASVGASCHS-DHE-DRPSPVLLSCGIPVDVARNAVRLSVGRSTTRAEV----DLIVQDLKQAVNQLEGPV----------------
8 PsiBlast_PDB 76.9135% -89 - C3 -1EG5 ? A:[3-364] ------------------------VYFDNNATTRVDDRVLEEMIVFYR---EKYGNPNSAHGMGIEANLHMEKAREKVAKVLGVSPSEIFFTSCATESINWILKTVA-ETF-------EKR-K-R--------T---IITTPIEHKAVLETMKYL-S-MKGFKVKYVPV-DS-RGVVKLEELEKLVD--EDTFLVSIMAANNEVGTIQPVEDVTRIVKK--K----------NKE--------TLVHVDAVQTIGKIPFSLEKLEVDYASFSAHKFHGPKGVGITYIRKG----VP--------IRPLIHGGGQERGLRSGTQNVPGIVGAARAMEIAVEELSEAAKHMEKLRSKLVS---GLMNLGAH--IITPL-EI---S---LPN--------TLSVSF--PNI--RGSTLQNLLSG--Y--GI-Y---VST---------------HVLDAMGVDRRIAQGAIRISLCKYNTEEEVDYFLKKIEEILSFL------------------------