@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Wbm0046: (2015-11-28 )
MEIILAEPRGFCAGVKRAVDILAITLKKYRNKRKVYVLHEIVHNKYIVEDFKRQGVIFVNSIRDIKDNRGILIFSAHGVSKNIEDKAKRKGIQVIDATCPLVSKVHKEAKRYEDSGKELILIGHKNHPEVKGIRGRVNNPIVLVQTLQNVRDLKVKNPDNLSYVTQTTLSTDDTREIITALKLRFPNITGPNLKDICYATQNRQNAVKKLTEIVDIVLIIGSKNSSNSNRLLDLCTARGKRAYLIDNYSYMDKSWLQGIEKIGITAGASAPDILVDELINHLKINVNTKVSVMSDGVTENVQFKIPHLV

Atome Classification :

(60 SA) -.........10........20........30........40........50........60........70........80........90........100.......110.......120.......130.....---.---.140-.........150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280.......290.......300.......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) -MEIILAEPRGFCAGVKRAVDILAITLKKYRNKRKVYVLHEIVHNKYIVEDFKRQGVIFVNSIRDIKDNRGILIFSAHGVSKNIEDKAKRKGIQVIDATCPLVSKVHKEAKRYEDSGKELILIGHKNHPEVKGIRGRV---N---NP---IVLVQTLQNVRDLKVKNPDNLSYVTQTTLSTDDTREIITALKLRFPNITGPNLKDICYATQNRQNAVKKLTEIVDIVLIIGSKNSSNSNRLLDLCTARGKRAYLIDNYSYMDKSWLQGIEKIGITAGASAPDILVDELINHLKINVNTKVSVMSDGVTENVQFKIPHLV
5 PsiBlast_PDB 97.3248%-106 - C10 -4MV5 ? A:[13-317] -MQILLANPRGFCAGVDRAISIVENALAIY--GAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDG-AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQY---S---NPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQ-QLGGGEAIPLEGREENIVFEVPKEL
3 PsiBlast_PDB 97.0248%-104 - C10 -4MV0 ? A:[13-317] -MQILLANPRGFCAGVDRAISIVENALAIY--GAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDG-AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQY---S---NPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQ-QLGGGEAIPLEGREENIVFEVPKEL
39 PsiBlast_CBE 97.0048%-103 - C10 -3UWM ISPH_ECOLI B:[9-313] -MQILLANPRGFCAGVDRAISIVENALAIY--GAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDG-AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQY---S---NPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQ-QLGGGEAIPLEGREENIVFEVPKEL
26 PsiBlast_CBE 96.7848%-103 - C10 -3SZO ISPH_ECOLI B:[13-317] -MQILLANPRGFCAGVDRAISIVENALAIY--GAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDG-AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQY---S---NPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQ-QLGGGEAIPLEGREENIVFEVPKEL
20 PsiBlast_PDB 96.7748%-103 - C10 -3UTC ISPH_ECOLI A:[9-313] -MQILLANPRGFCAGVDRAISIVENALAIY--GAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDG-AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQY---S---NPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQ-QLGGGEAIPLEGREENIVFEVPKEL
1 PsiBlast_PDB 96.7548%-105 - C10 -4EB3 ISPH_ECOLI A:[13-317] -MQILLANPRGFCAGVDRAISIVENALAIY--GAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDG-AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQY---S---NPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQ-QLGGGEAIPLEGREENIVFEVPKEL
42 PsiBlast_CBE 96.7148%-100 - C10 -3UV7 ISPH_ECOLI A:[9-313] -MQILLANPRGFCAGVDRAISIVENALAIY--GAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDG-AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQY---S---NPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQ-QLGGGEAIPLEGREENIVFEVPKEL
25 PsiBlast_CBE 96.6748%-103 - C10 -4EB3 ISPH_ECOLI B:[13-317] -MQILLANPRGFCAGVDRAISIVENALAIY--GAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDG-AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQY---S---NPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQ-QLGGGEAIPLEGREENIVFEVPKEL
48 PsiBlast_CBE 96.6448%-100 - C10 -3UTD ISPH_ECOLI A:[9-313] -MQILLANPRGFCAGVDRAISIVENALAIY--GAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDG-AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQY---S---NPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQ-QLGGGEAIPLEGREENIVFEVPKEL
36 PsiBlast_CBE 96.5948%-104 - C10 -4H4E ISPH_ECOLI B:[9-313] -MQILLANPRGFCAGVDRAISIVENALAIY--GAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDG-AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQY---S---NPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQ-QLGGGEAIPLEGREENIVFEVPKEL
27 PsiBlast_CBE 96.5148%-105 - C10 -3SZL ISPH_ECOLI B:[13-317] -MQILLANPRGFCAGVDRAISIVENALAIY--GAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDG-AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQY---S---NPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQ-QLGGGEAIPLEGREENIVFEVPKEL
33 PsiBlast_CBE 96.4848%-105 - C10 -3KE8 ISPH_ECOLI B:[11-315] -MQILLANPRGFCAGVDRAISIVENALAIY--GAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDG-AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQY---S---NPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQ-QLGGGEAIPLEGREENIVFEVPKEL
31 PsiBlast_CBE 96.4748%-102 - C10 -3KEF ISPH_ECOLI B:[11-315] -MQILLANPRGFCAGVDRAISIVENALAIY--GAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDG-AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQY---S---NPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQ-QLGGGEAIPLEGREENIVFEVPKEL
34 PsiBlast_CBE 96.4548%-104 - C10 -3ZGN ISPH_ECOLI B:[17-321] -MQILLANPRGFCAGVDRAISIVENALAIY--GAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDG-AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQY---S---NPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQ-QLGGGEAIPLEGREENIVFEVPKEL
45 PsiBlast_CBE 96.3848%-104 - C10 -3UV3 ISPH_ECOLI B:[9-313] -MQILLANPRGFCAGVDRAISIVENALAIY--GAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDG-AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQY---S---NPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQ-QLGGGEAIPLEGREENIVFEVPKEL
11 PsiBlast_PDB 96.3648%-102 - C10 -3KEF ISPH_ECOLI A:[11-315] -MQILLANPRGFCAGVDRAISIVENALAIY--GAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDG-AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQY---S---NPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQ-QLGGGEAIPLEGREENIVFEVPKEL
46 PsiBlast_CBE 96.3348%-101 - C10 -3UV3 ISPH_ECOLI A:[9-313] -MQILLANPRGFCAGVDRAISIVENALAIY--GAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDG-AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQY---S---NPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQ-QLGGGEAIPLEGREENIVFEVPKEL
22 PsiBlast_CBE 96.3348%-106 - C10 -4MV0 ? B:[13-317] -MQILLANPRGFCAGVDRAISIVENALAIY--GAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDG-AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQY---S---NPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQ-QLGGGEAIPLEGREENIVFEVPKEL
47 PsiBlast_CBE 96.2648%-105 - C10 -3UTD ISPH_ECOLI B:[9-313] -MQILLANPRGFCAGVDRAISIVENALAIY--GAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDG-AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQY---S---NPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQ-QLGGGEAIPLEGREENIVFEVPKEL
19 PsiBlast_PDB 96.2648%-101 - C10 -3URK ISPH_ECOLI A:[9-313] -MQILLANPRGFCAGVDRAISIVENALAIY--GAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDG-AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQY---S---NPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQ-QLGGGEAIPLEGREENIVFEVPKEL
53 PsiBlast_CBE 96.2548%-111 - C10 -3T0F ISPH_ECOLI B:[13-317] -MQILLANPRGFCAGVDRAISIVENALAIY--GAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDG-AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAG------TMGQ----------GG-MYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQ-QLGGGEAIPLEGREENIVFEVPKEL
56 PsiBlast_CBE 96.1748%-101 * C10 *3T0G ISPH_ECOLI A:[13-317] -MQILLANPRGFCAGVDRAISIVENALAIY--GAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDG-AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQY---S---NPEGGMYLVESPDDVWKLTVKNEEKLSFMTQCTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQ-QLGGGEAIPLEGREENIVFEVPKEL
44 PsiBlast_CBE 96.1748%-102 - C10 -3UV6 ISPH_ECOLI A:[9-313] -MQILLANPRGFCAGVDRAISIVENALAIY--GAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDG-AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQY---S---NPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQ-QLGGGEAIPLEGREENIVFEVPKEL
2 PsiBlast_PDB 96.1548%-102 - C10 -4MUY ? A:[13-317] -MQILLANPRGFCAGVDRAISIVENALAIY--GAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDG-AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQY---S---NPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQ-QLGGGEAIPLEGREENIVFEVPKEL
13 PsiBlast_PDB 96.1448%-104 - C10 -3KEM ISPH_ECOLI A:[11-315] -MQILLANPRGFCAGVDRAISIVENALAIY--GAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDG-AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQY---S---NPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQ-QLGGGEAIPLEGREENIVFEVPKEL
21 PsiBlast_CBE 96.1348%-106 - C10 -4MV5 ? B:[13-317] -MQILLANPRGFCAGVDRAISIVENALAIY--GAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDG-AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQY---S---NPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQ-QLGGGEAIPLEGREENIVFEVPKEL
43 PsiBlast_CBE 96.0848%-103 - C10 -3UV6 ISPH_ECOLI B:[9-313] -MQILLANPRGFCAGVDRAISIVENALAIY--GAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDG-AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQY---S---NPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQ-QLGGGEAIPLEGREENIVFEVPKEL
52 PsiBlast_CBE 96.0048% -99 - C10 -3SZU ISPH_ECOLI A:[13-317] -MQILLANPRGFCAGVDRAISIVENALAIY--GAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDG-AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPQVEGTMGQY---S---NPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQ-QLGGGEAIPLEGREENIVFEVPKEL
16 PsiBlast_PDB 96.0048%-101 - C10 -4H4C ISPH_ECOLI A:[9-313] -MQILLANPRGFCAGVDRAISIVENALAIY--GAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDG-AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQY---S---NPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQ-QLGGGEAIPLEGREENIVFEVPKEL
41 PsiBlast_CBE 95.9848%-103 - C10 -3UV7 ISPH_ECOLI B:[9-313] -MQILLANPRGFCAGVDRAISIVENALAIY--GAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDG-AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQY---S---NPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQ-QLGGGEAIPLEGREENIVFEVPKEL
40 PsiBlast_CBE 95.9548%-102 - C10 -3UWM ISPH_ECOLI A:[9-313] -MQILLANPRGFCAGVDRAISIVENALAIY--GAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDG-AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQY---S---NPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQ-QLGGGEAIPLEGREENIVFEVPKEL
32 PsiBlast_CBE 95.9348%-104 - C10 -3KE9 ISPH_ECOLI B:[11-315] -MQILLANPRGFCAGVDRAISIVENALAIY--GAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDG-AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQY---S---NPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQ-QLGGGEAIPLEGREENIVFEVPKEL
4 PsiBlast_PDB 95.9048%-103 - C10 -4MUX ? A:[13-317] -MQILLANPRGFCAGVDRAISIVENALAIY--GAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDG-AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQY---S---NPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQ-QLGGGEAIPLEGREENIVFEVPKEL
29 PsiBlast_CBE 95.8948%-103 - C10 -3KEM ISPH_ECOLI B:[11-315] -MQILLANPRGFCAGVDRAISIVENALAIY--GAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDG-AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQY---S---NPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQ-QLGGGEAIPLEGREENIVFEVPKEL
30 PsiBlast_CBE 95.8548%-103 - C10 -3KEL ISPH_ECOLI B:[11-315] -MQILLANPRGFCAGVDRAISIVENALAIY--GAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDG-AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQY---S---NPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQ-QLGGGEAIPLEGREENIVFEVPKEL
10 PsiBlast_PDB 95.8348%-104 - C10 -3KE9 ISPH_ECOLI A:[11-315] -MQILLANPRGFCAGVDRAISIVENALAIY--GAPIYVRHEVVHNRYVVDSLRERGAIFIEQISEVPDG-AILIFSAHGVSQAVRNEAKSRDLTVFDATCPLVTKVHMEVARASRRGEESILIGHAGHPEVEGTMGQY---S---NPEGGMYLVESPDDVWKLTVKNEEKLSFMTQTTLSVDDTSDVIDALRKRFPKIVGPRKDDICYATTNRQEAVRALAEQAEVVLVVGSKNSSNSNRLAELAQRMGKRAFLIDDAKDIQEEWVKEVKCVGVTAGASAPDILVQNVVARLQ-QLGGGEAIPLEGREENIVFEVPKEL