@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Wbm0112: (2015-11-28 )
MSITLHSQKDFEFMRKAGRLAAETLDFIAPYVKVGVTTNKLNDLCHDFIVKAGAIPAPLNYKGYPKSICTSKNAVVCHGIPDDKPLKDGDILNIDVTVILNGWYGDTSRMFWAGKPSIKAKRLCDATYVALMEAIKQVKPGNKLNEIGLAVEKYIRDFGYSIVRSYCGHGIGKVFHAPPNVVHFYDQGESLVLKEGMFFTIEPMINAGKHETLLSRLDNWTVTTRDLSLSAQFEHTLGVTEDGVEIFTLSPKNWHFPPYN

Atome Classification :

(91 SA) .....--....10........20........30........40........50.......-..60........70........80..-......90........100.......110.......120.......130.......140.......150.....--..160--.........170.......180.......190.......200......--.210.......220.......230.......240.......250.......260
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MSITL--HSQKDFEFMRKAGRLAAETLDFIAPYVKVGVTTNKLNDLCHDFIV-KAGAIPA-PLNYKGYPKSICTSKNAVVCHGIPDD-KPLKDGDILNIDVTVILNGWYGDTSRMFWAGKPSIKAKRLCDATYVALMEAIKQVKPGNKLNEIGLAVEKYIRD--FGY----SIVRSYCGHGIGKVFHAPPNVVHFYDQGESLVLKEGMFFTIEPMINAG--KHETLLSRLDNWTVTTRDLSLSAQFEHTLGVTEDGVEIFTLSPKNWHFPPYN
21 PsiBlast_CBE 96.2966%-105 - C1 -3MX6 MAP1_RICPR B:[6-262] --IKI--HTEKDFIKMRAAGKLAAETLDFITDHVKPNVTTNSLNDLCHNFIT-SHNAIPA-PLNYKGFPKSICTSINHVVCHGIPND-KPLKNGDIVNIDVTVILDGWYGDTSRMYYVGDVAIKPKRLIQVTYDAMMKGIEVVRPGAKLGDIGYAIQSYAEK--HNY----SVVRDYTGHGIGRVFHDKPSILNYGRNGTGLTLKEGMFFTVEPMINAG--NYDTILSKLDGWTVTTRDKSLSAQFEHTIGVTKDGFEIFTLSPKKLDYPPY-
101 HHSearch 95.8566%-108 - C1 -3MX6 MAP1_RICPR A:[6-262] --IKI--HTEKDFIKMRAAGKLAAETLDFITDHVKPNVTTNSLNDLCHNFIT-SHNAIPA-PLNYKGFPKSICTSINHVVCHGIPND-KPLKNGDIVNIDVTVILDGWYGDTSRMYYVGDVAIKPKRLIQVTYDAMMKGIEVVRPGAKLGDIGYAIQSYAEK--HNY----SVVRDYTGHGIGRVFHDKPSILNYGRNGTGLTLKEGMFFTVEPMINAG--NYDTILSKLDGWTVTTRDKSLSAQFEHTIGVTKDGFEIFTLSPKKLDYPPY-
1 PsiBlast_PDB 95.8566%-108 - C1 -3MX6 MAP1_RICPR A:[6-262] --IKI--HTEKDFIKMRAAGKLAAETLDFITDHVKPNVTTNSLNDLCHNFIT-SHNAIPA-PLNYKGFPKSICTSINHVVCHGIPND-KPLKNGDIVNIDVTVILDGWYGDTSRMYYVGDVAIKPKRLIQVTYDAMMKGIEVVRPGAKLGDIGYAIQSYAEK--HNY----SVVRDYTGHGIGRVFHDKPSILNYGRNGTGLTLKEGMFFTVEPMINAG--NYDTILSKLDGWTVTTRDKSLSAQFEHTIGVTKDGFEIFTLSPKKLDYPPY-
22 PsiBlast_CBE 90.4366%-108 - C1 -3MR1 MAP1_RICPR D:[6-252] --IKI--HTEKDFIKMRAAGKLAAETLDFITDHVKPNVTTNSLNDLCHNFIT-SHNAIPA-PLNYKGFPKSICTSINHVVCHGIPND-KPLKNGDIVNIDVTVILDGWYGDTSRMYYVGDVAIKPKRLIQVTYDAMMKGIEVVRPGAKLGDIGYAIQSYAEK--HNY----SVVRDYTGHGIGRVFHDKPSILNYGRNGTGLTLKEGMFFTVEPMINAG--NYDTILSKLDGWTVTTRDKSLSAQFEHTIGVTKDGFEIFTL-----------
24 PsiBlast_CBE 89.7066%-108 - C1 -3MR1 MAP1_RICPR B:[6-252] --IKI--HTEKDFIKMRAAGKLAAETLDFITDHVKPNVTTNSLNDLCHNFIT-SHNAIPA-PLNYKGFPKSICTSINHVVCHGIPND-KPLKNGDIVNIDVTVILDGWYGDTSRMYYVGDVAIKPKRLIQVTYDAMMKGIEVVRPGAKLGDIGYAIQSYAEK--HNY----SVVRDYTGHGIGRVFHDKPSILNYGRNGTGLTLKEGMFFTVEPMINAG--NYDTILSKLDGWTVTTRDKSLSAQFEHTIGVTKDGFEIFTL-----------
23 PsiBlast_CBE 89.2666%-106 - C1 -3MR1 MAP1_RICPR C:[6-252] --IKI--HTEKDFIKMRAAGKLAAETLDFITDHVKPNVTTNSLNDLCHNFIT-SHNAIPA-PLNYKGFPKSICTSINHVVCHGIPND-KPLKNGDIVNIDVTVILDGWYGDTSRMYYVGDVAIKPKRLIQVTYDAMMKGIEVVRPGAKLGDIGYAIQSYAEK--HNY----SVVRDYTGHGIGRVFHDKPSILNYGRNGTGLTLKEGMFFTVEPMINAG--NYDTILSKLDGWTVTTRDKSLSAQFEHTIGVTKDGFEIFTL-----------
49 PsiBlast_CBE 88.5356%-109 - C1 -1C22 MAP1_ECOLI A:[1-249] -AISI--KTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSA-CLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEA--EGF----SVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAG--KKE-IRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIIS
2 PsiBlast_PDB 88.5266%-104 - C1 -3MR1 MAP1_RICPR A:[6-252] --IKI--HTEKDFIKMRAAGKLAAETLDFITDHVKPNVTTNSLNDLCHNFIT-SHNAIPA-PLNYKGFPKSICTSINHVVCHGIPND-KPLKNGDIVNIDVTVILDGWYGDTSRMYYVGDVAIKPKRLIQVTYDAMMKGIEVVRPGAKLGDIGYAIQSYAEK--HNY----SVVRDYTGHGIGRVFHDKPSILNYGRNGTGLTLKEGMFFTVEPMINAG--NYDTILSKLDGWTVTTRDKSLSAQFEHTIGVTKDGFEIFTL-----------
52 PsiBlast_CBE 86.8956%-108 - C1 -2Q92 MAP1_ECOLI A:[1-249] -AISI--KTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSA-CLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEA--EGF----SVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAG--KKE-IRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIIS
14 PsiBlast_PDB 86.7056%-109 - C1 -2MAT MAP1_ECOLI A:[2-250] -AISI--KTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSA-CLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEA--EGF----SVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAG--KKE-IRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIIS
40 PsiBlast_CBE 86.5856%-111 - C1 -2GGB MAP1_ECOLI A:[1-249] -AISI--KTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSA-CLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEA--EGF----SVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAG--KKE-IRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIIS
47 PsiBlast_CBE 86.4956%-109 - C1 -1C24 MAP1_ECOLI A:[1-249] -AISI--KTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSA-CLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEA--EGF----SVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAG--KKE-IRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIIS
48 PsiBlast_CBE 86.3356%-110 - C1 -1C23 MAP1_ECOLI A:[1-249] -AISI--KTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSA-CLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEA--EGF----SVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAG--KKE-IRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIIS
8 PsiBlast_PDB 86.2356%-109 - C1 -2BB7 MAP1_ECOLI A:[5-250] ----I--KTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSA-CLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEA--EGF----SVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAG--KKE-IRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIIS
46 PsiBlast_CBE 86.0656%-109 - C1 -1C27 MAP1_ECOLI A:[1-249] -AISI--KTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSA-CLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEA--EGF----SVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAG--KKE-IRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIIS
50 PsiBlast_CBE 85.9656%-106 - C1 -1C21 MAP1_ECOLI A:[1-249] -AISI--KTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSA-CLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEA--EGF----SVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAG--KKE-IRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIIS
16 PsiBlast_PDB 85.8856%-109 - C1 -4A6W ? A:[2-250] -AISI--KTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSA-CLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEA--EGF----SVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAG--KKE-IRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIIS
42 PsiBlast_CBE 85.8356%-109 - C1 -2GG8 MAP1_ECOLI A:[1-249] -AISI--KTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSA-CLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEA--EGF----SVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAG--KKE-IRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIIS
15 PsiBlast_PDB 85.6956%-110 - C1 -1YVM MAP1_ECOLI A:[2-250] -AISI--KTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSA-CLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEA--EGF----SVVREYCGHGIGQGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAG--KKE-IRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIIS
36 PsiBlast_CBE 85.6656%-109 - C1 -2Q96 MAP1_ECOLI A:[1-249] -AISI--KTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSA-CLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEA--EGF----SVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAG--KKE-IRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIIS
53 PsiBlast_CBE 85.5656%-109 - C1 -2P9A MAP1_ECOLI A:[1-249] -AISI--KTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSA-CLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEA--EGF----SVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAG--KKE-IRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIIS
39 PsiBlast_CBE 85.4956%-109 - C1 -2GGC MAP1_ECOLI A:[1-249] -AISI--KTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSA-CLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEA--EGF----SVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAG--KKE-IRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIIS
41 PsiBlast_CBE 85.4256%-108 - C1 -2GG9 MAP1_ECOLI A:[1-249] -AISI--KTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSA-CLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEA--EGF----SVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAG--KKE-IRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIIS
6 PsiBlast_PDB 85.3356%-107 - C1 -4A6V ? A:[2-250] -AISI--KTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSA-CLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEA--EGF----SVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAG--KKE-IRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIIS
19 PsiBlast_PDB 84.7256%-108 - C1 -2GG0 MAP1_ECOLI A:[2-249] --ISI--KTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSA-CLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEA--EGF----SVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAG--KKE-IRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIIS
43 PsiBlast_CBE 84.6756%-109 - C1 -2GG7 MAP1_ECOLI A:[1-249] -AISI--KTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSA-CLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEA--EGF----SVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAG--KKE-IRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIIS