@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Wbm0470: (2015-12-01 )
MAISLLQGKKGLITGIINKRSIAYGIVKTLSEHGAESAVTYQNEIVKERLLSIAAELNVELVLNCDVANEGTIDDVFKSIEEKWGTLDFLVHAIAFSDKNELSGKYVNTSLNNFQNAMNISCYSFTALAQRAEKMMPNGGSLLTLSYYGAEKVMPNYNVMGLCKAALEASVKYLACDLGPQNIRVNAISAGPIRTLASSGISDFHFISEWNRNNSPLRRNTTLEDVGKAALYLLSDLSSGTTGEILHVDSGYNVVGMKAIDSNIINSYQN

Atome Classification :

(78 SA) .........10........20........30.-.......40........50......--..-----------60-.........70........80.....-...90........100......-.---110.......120.......130....-..---.140.......150.....--..160.......170......--.180.......190.......200.......210.......220-.........230...-....240.......250...--....260.......270
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MAISLLQGKKGLITGIINKRSIAYGIVKTLSE-HGAESAVTYQNEIVKERLLSIAAEL--NV-----------E--LVLNCDVANEGTIDDVFKSIEEKWGT-LDFLVHAIAFSDKNELSGKYVN-T---SLNNFQNAMNISCYSFTALAQRAEKMM-PN---GGSLLTLSYYGAEKVMPNY--NVMGLCKAALEASVKYLACDL--GPQNIRVNAISAGPIRTLASSGISDFHFISEWNRNNSPLRRN---TTLEDVGKAALYLLS-DLSSGTTGEILHVDSGYNVV--GMKAIDSNIINSYQN
1 PsiBlast_PDB 93.7865%-111 - C1 -3K2E ? A:[27-282] ----LMEGKKGVIIGVANDKSLAWGIAKAVCA-QGAEVALTYLSETFKKRVDPLAESL--GV-----------K--LTVPCDVSDAESVDNMFKVLAEEWGS-LDFVVHAVAFSDKNELKGRYVD-T---SLGNFLTSMHISCYSFTYIASKAEPLM-TN---GGSILTLSYYGAEKVVPHY--NVMGVCKAALEASVKYLAVDL--GKQQIRVNAISAGPVRTLASSGISDFHYILTWNKYNSPLRRN---TTLDDVGGAALYLLS-DLGRGTTGETVHVDCGYHVV--GMKSV----------
2 PsiBlast_PDB 92.9065%-110 - C1 -3K31 ? A:[27-282] ----LMEGKKGVIIGVANDKSLAWGIAKAVCA-QGAEVALTYLSETFKKRVDPLAESL--GV-----------K--LTVPCDVSDAESVDNMFKVLAEEWGS-LDFVVHAVAFSDKNELKGRYVD-T---SLGNFLTSMHISCYSFTYIASKAEPLM-TN---GGSILTLSYYGAEKVVPHY--NVMGVCKAALEASVKYLAVDL--GKQQIRVNAISAGPVRTLASSGISDFHYILTWNKYNSPLRRN---TTLDDVGGAALYLLS-DLGRGTTGETVHVDCGYHVV--GMKSV----------
21 PsiBlast_CBE 92.3665%-108 - C1 -3K31 ? B:[27-287] ----LMEGKKGVIIGVANDKSLAWGIAKAVCA-QGAEVALTYLSETFKKRVDPLAESL--GV-----------K--LTVPCDVSDAESVDNMFKVLAEEWGS-LDFVVHAVAFSDKNELKGRYVD-T---SLGNFLTSMHISCYSFTYIASKAEPLM-TN---GGSILTLSYYGAEKVVPHY--NVMGVCKAALEASVKYLAVDL--GKQQIRVNAISAGPVR-------SDFHYILTWNKYNSPLRRN---TTLDDVGGAALYLLS-DLGRGTTGETVHVDCGYHVV--GMKSVDAPDI-----
22 PsiBlast_CBE 92.1565%-108 - C1 -3K2E ? B:[27-287] ----LMEGKKGVIIGVANDKSLAWGIAKAVCA-QGAEVALTYLSETFKKRVDPLAESL--GV-----------K--LTVPCDVSDAESVDNMFKVLAEEWGS-LDFVVHAVAFSDKNELKGRYVD-T---SLGNFLTSMHISCYSFTYIASKAEPLM-TN---GGSILTLSYYGAEKVVPHY--NVMGVCKAALEASVKYLAVDL--GKQQIRVNAISAGPVR-------SDFHYILTWNKYNSPLRRN---TTLDDVGGAALYLLS-DLGRGTTGETVHVDCGYHVV--GMKSVDAPDI-----
3 PsiBlast_PDB 90.0662%-109 - C1 -3GRK - ? A:[7-259] ----LLQGKRGLILGVANNRSIAWGIAKAARE-AGAELAFTYQGDALKKRVEPLAEEL--GA-----------F--VAGHCDVADAASIDAVFETLEKKWGK-LDFLVHAIGFSDKDELTGRYID-T---SEANFTNTMLISVYSLTAVSRRAEKLM-AD---GGSILTLTYYGAEKVMPNY--NVMGVAKAALEASVKYLAVDL--GPQNIRVNAISAGPIKT------GDFRYILKWNEYNAPLRRT---VTIDEVGDVGLYFLS-DLSRSVTGEVHHADSGYHVI--GM-------------
30 PsiBlast_CBE 87.8651%-110 - C1 -4NK4 ? B:[36-292] --INILKGKRGLIMGVANDHSIAWGIAKVLHS-AGAQLAFSYQGESIGKRLKPLALTV--DS-----------D--FMIPCNVEDPSSMDLLFERIKERWET-LDFVVHSIAFSDKNELRGPYYN-T---SRDNFIQTMLVSCFSFTEIVRRAAQLM-PH---GGAMITLTYGGSMRVVPNY--NAMAPAKSALESSTKYLACDY--GGMNIRINAISAGPVRTLAGASISNGRDIAAWSKENSPLKRT---VSLEDIGNSALYLLS-YLSNGVTGEIHYVDCGYNIV--AMPS-----------
95 PsiBlast_CBE 87.8048%-108 - C1 -3OJF FABI_BACCR D:[2-257] ---ELLQGKTFVVMGVANQRSIAWGIARSLHN-AGAKLIFTYAGERLERNVRELADTL--EG-----------QESLVLPCDVTNDEELTACFETIKQEVGT-IHGVAHCIAFANRDDLKGEFVD-T---SRDGFLLAQNISAFSLTAVAREAKKVM-TE---GGNILTLTYLGGERVVKNY--NVMGVAKASLEASVKYLANDL--GQHGIRVNAISAGPIRTLSAKGVGDFNSILREIEERAPLRRT---TTQEEVGDTAVFLFS-DLARGVTGENIHVDSGYHIL--GL-------------
69 PsiBlast_CBE 87.7251%-105 - C1 -2PD4 FABI_HELPY D:[2-259] ---GFLKGKKGLIVGVANNKSIAYGIAQSCFN-QGATLAFTYLNESLEKRVRPIAQEL--NS-----------P--YVYELDVSKEEHFKSLYNSVKKDLGS-LDFIVHSVAFAPKEALEGSLLE-T---SKSAFNTAMEISVYSLIELTNTLKPLL-NN---GASVLTLSYLGSTKYMAHY--NVMGLAKAALESAVRYLAVDL--GKHHIRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKN---VSLEEVGNAGMYLLS-SLSSGVSGEVHFVDAGYHVM--GMGAVEEKDNKATLL
27 PsiBlast_CBE 87.4251%-108 - C1 -4NK4 ? E:[36-292] --INILKGKRGLIMGVANDHSIAWGIAKVLHS-AGAQLAFSYQGESIGKRLKPLALTV--DS-----------D--FMIPCNVEDPSSMDLLFERIKERWET-LDFVVHSIAFSDKNELRGPYYN-T---SRDNFIQTMLVSCFSFTEIVRRAAQLM-PH---GGAMITLTYGGSMRVVPNY--NAMAPAKSALESSTKYLACDY--GGMNIRINAISAGPVRTLAGASISNGRDIAAWSKENSPLKRT---VSLEDIGNSALYLLS-YLSNGVTGEIHYVDCGYNIV--AMPS-----------
74 PsiBlast_CBE 87.2351%-107 - C1 -2PD3 FABI_HELPY C:[2-259] ---GFLKGKKGLIVGVANNKSIAYGIAQSCFN-QGATLAFTYLNESLEKRVRPIAQEL--NS-----------P--YVYELDVSKEEHFKSLYNSVKKDLGS-LDFIVHSVAFAPKEALEGSLLE-T---SKSAFNTAMEISVYSLIELTNTLKPLL-NN---GASVLTLSYLGSTKYMAHY--NVMGLAKAALESAVRYLAVDL--GKHHIRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKN---VSLEEVGNAGMYLLS-SLSSGVSGEVHFVDAGYHVM--GMGAVEEKDNKATLL
5 PsiBlast_PDB 87.0451%-108 - C1 -4NK4 ? A:[36-292] --INILKGKRGLIMGVANDHSIAWGIAKVLHS-AGAQLAFSYQGESIGKRLKPLALTV--DS-----------D--FMIPCNVEDPSSMDLLFERIKERWET-LDFVVHSIAFSDKNELRGPYYN-T---SRDNFIQTMLVSCFSFTEIVRRAAQLM-PH---GGAMITLTYGGSMRVVPNY--NAMAPAKSALESSTKYLACDY--GGMNIRINAISAGPVRTLAGASISNGRDIAAWSKENSPLKRT---VSLEDIGNSALYLLS-YLSNGVTGEIHYVDCGYNIV--AMPS-----------
76 PsiBlast_CBE 86.9051%-106 - C1 -2PD3 FABI_HELPY A:[2-259] ---GFLKGKKGLIVGVANNKSIAYGIAQSCFN-QGATLAFTYLNESLEKRVRPIAQEL--NS-----------P--YVYELDVSKEEHFKSLYNSVKKDLGS-LDFIVHSVAFAPKEALEGSLLE-T---SKSAFNTAMEISVYSLIELTNTLKPLL-NN---GASVLTLSYLGSTKYMAHY--NVMGLAKAALESAVRYLAVDL--GKHHIRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKN---VSLEEVGNAGMYLLS-SLSSGVSGEVHFVDAGYHVM--GMGAVEEKDNKATLL
75 PsiBlast_CBE 86.8551%-102 - C1 -2PD3 FABI_HELPY B:[2-259] ---GFLKGKKGLIVGVANNKSIAYGIAQSCFN-QGATLAFTYLNESLEKRVRPIAQEL--NS-----------P--YVYELDVSKEEHFKSLYNSVKKDLGS-LDFIVHSVAFAPKEALEGSLLE-T---SKSAFNTAMEISVYSLIELTNTLKPLL-NN---GASVLTLSYLGSTKYMAHY--NVMGLAKAALESAVRYLAVDL--GKHHIRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKN---VSLEEVGNAGMYLLS-SLSSGVSGEVHFVDAGYHVM--GMGAVEEKDNKATLL
25 PsiBlast_CBE 86.7851%-109 - C1 -4NK5 ? C:[36-292] --INILKGKRGLIMGVANDHSIAWGIAKVLHS-AGAQLAFSYQGESIGKRLKPLALTV--DS-----------D--FMIPCNVEDPSSMDLLFERIKERWET-LDFVVHSIAFSDKNELRGPYYN-T---SRDNFIQTMLVSCFSFTEIVRRAAQLM-PH---GGAMITLTYGGSMRVVPNY--NAMAPAKSALESSTKYLACDY--GGMNIRINAISAGPVRTLAGASISNGRDIAAWSKENSPLKRT---VSLEDIGNSALYLLS-YLSNGVTGEIHYVDCGYNIV--AMPS-----------
28 PsiBlast_CBE 86.6851%-108 - C1 -4NK4 ? D:[36-292] --INILKGKRGLIMGVANDHSIAWGIAKVLHS-AGAQLAFSYQGESIGKRLKPLALTV--DS-----------D--FMIPCNVEDPSSMDLLFERIKERWET-LDFVVHSIAFSDKNELRGPYYN-T---SRDNFIQTMLVSCFSFTEIVRRAAQLM-PH---GGAMITLTYGGSMRVVPNY--NAMAPAKSALESSTKYLACDY--GGMNIRINAISAGPVRTLAGASISNGRDIAAWSKENSPLKRT---VSLEDIGNSALYLLS-YLSNGVTGEIHYVDCGYNIV--AMPS-----------
71 PsiBlast_CBE 86.6251%-105 - C1 -2PD4 FABI_HELPY B:[2-259] ---GFLKGKKGLIVGVANNKSIAYGIAQSCFN-QGATLAFTYLNESLEKRVRPIAQEL--NS-----------P--YVYELDVSKEEHFKSLYNSVKKDLGS-LDFIVHSVAFAPKEALEGSLLE-T---SKSAFNTAMEISVYSLIELTNTLKPLL-NN---GASVLTLSYLGSTKYMAHY--NVMGLAKAALESAVRYLAVDL--GKHHIRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKN---VSLEEVGNAGMYLLS-SLSSGVSGEVHFVDAGYHVM--GMGAVEEKDNKATLL
29 PsiBlast_CBE 86.4251%-108 - C1 -4NK4 ? C:[36-292] --INILKGKRGLIMGVANDHSIAWGIAKVLHS-AGAQLAFSYQGESIGKRLKPLALTV--DS-----------D--FMIPCNVEDPSSMDLLFERIKERWET-LDFVVHSIAFSDKNELRGPYYN-T---SRDNFIQTMLVSCFSFTEIVRRAAQLM-PH---GGAMITLTYGGSMRVVPNY--NAMAPAKSALESSTKYLACDY--GGMNIRINAISAGPVRTLAGASISNGRDIAAWSKENSPLKRT---VSLEDIGNSALYLLS-YLSNGVTGEIHYVDCGYNIV--AMPS-----------
73 PsiBlast_CBE 86.3751%-106 - C1 -2PD3 FABI_HELPY D:[2-259] ---GFLKGKKGLIVGVANNKSIAYGIAQSCFN-QGATLAFTYLNESLEKRVRPIAQEL--NS-----------P--YVYELDVSKEEHFKSLYNSVKKDLGS-LDFIVHSVAFAPKEALEGSLLE-T---SKSAFNTAMEISVYSLIELTNTLKPLL-NN---GASVLTLSYLGSTKYMAHY--NVMGLAKAALESAVRYLAVDL--GKHHIRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKN---VSLEEVGNAGMYLLS-SLSSGVSGEVHFVDAGYHVM--GMGAVEEKDNKATLL
72 PsiBlast_CBE 86.2951%-104 - C1 -2PD4 FABI_HELPY A:[2-259] ---GFLKGKKGLIVGVANNKSIAYGIAQSCFN-QGATLAFTYLNESLEKRVRPIAQEL--NS-----------P--YVYELDVSKEEHFKSLYNSVKKDLGS-LDFIVHSVAFAPKEALEGSLLE-T---SKSAFNTAMEISVYSLIELTNTLKPLL-NN---GASVLTLSYLGSTKYMAHY--NVMGLAKAALESAVRYLAVDL--GKHHIRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKN---VSLEEVGNAGMYLLS-SLSSGVSGEVHFVDAGYHVM--GMGAVEEKDNKATLL
26 PsiBlast_CBE 86.2651%-109 - C1 -4NK4 ? F:[36-292] --INILKGKRGLIMGVANDHSIAWGIAKVLHS-AGAQLAFSYQGESIGKRLKPLALTV--DS-----------D--FMIPCNVEDPSSMDLLFERIKERWET-LDFVVHSIAFSDKNELRGPYYN-T---SRDNFIQTMLVSCFSFTEIVRRAAQLM-PH---GGAMITLTYGGSMRVVPNY--NAMAPAKSALESSTKYLACDY--GGMNIRINAISAGPVRTLAGASISNGRDIAAWSKENSPLKRT---VSLEDIGNSALYLLS-YLSNGVTGEIHYVDCGYNIV--AMPS-----------
70 PsiBlast_CBE 86.2551%-104 - C1 -2PD4 FABI_HELPY C:[2-259] ---GFLKGKKGLIVGVANNKSIAYGIAQSCFN-QGATLAFTYLNESLEKRVRPIAQEL--NS-----------P--YVYELDVSKEEHFKSLYNSVKKDLGS-LDFIVHSVAFAPKEALEGSLLE-T---SKSAFNTAMEISVYSLIELTNTLKPLL-NN---GASVLTLSYLGSTKYMAHY--NVMGLAKAALESAVRYLAVDL--GKHHIRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKN---VSLEEVGNAGMYLLS-SLSSGVSGEVHFVDAGYHVM--GMGAVEEKDNKATLL
7 PsiBlast_PDB 85.6950%-106 - C1 -4BKU ? A:[2-258] ---GFLDGKRILLTGLLSNRSIAYGIAKACKR-EGAELAFTYVGDRFKDRITEFAAEF--GS-----------E--LVFPCDVADDAQIDALFASLKTHWDS-LDGLVHSIGFAPREAIAGDFLDGL---TRENFRIAHDISAYSFPALAKAALPML-SD---DASLLTLSYLGAERAIPNY--NTMGLAKAALEASVRYLAVSL--GAKGVRVNAISAGPIKTLAASGIKSFGKILDFVESNSPLKRN---VTIEQVGNAGAFLLS-DLASGVTAEVMHVDSGFNAVVGGM-------------
11 PsiBlast_PDB 85.5548%-107 - C1 -1I2Z FABI_ECOLI A:[2-258] ---GFLSGKRILVTGVASKLSIAYGIAQAMHR-EGAELAFTYQNDKLKGRVEEFAAQL--GS-----------D--IVLQCDVAEDASIDTMFAELGKVWPK-FDGFVHSIGFAPGDQLDGDYVNAV---TREGFKIAHDISSYSFVAMAKACRSML-NP---GSALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAM--GPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIA--AMNE-----------
64 PsiBlast_CBE 85.1348%-103 - C1 -1DFH FABI_ECOLI A:[2-257] ----FLSGKRILVTGVASKLSIAYGIAQAMHR-EGAELAFTYQNDKLKGRVEEFAAQL--GS-----------D--IVLQCDVAEDASIDTMFAELGKVWPK-FDGFVHSIGFAPGDQLDGDYVNAV---TREGFKIAHDISSYSFVAMAKACRSML-NP---GSALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAM--GPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIA--AMNE-----------
47 PsiBlast_CBE 85.0648%-111 - C1 -4D46 ? B:[2-256] ---GFLSGKRILVTGVASKLSIAYGIAQAMHR-EGAELAFTYQNDKLKGRVEEFAAQL--GS-----------D--IVLQCDVAEDASIDTMFAELGKVWPK-FDGFVHSIGFAPGDQLDGDYVN-AV--TREGFKIAHDISSYSFVAMAKACRSML-NP---GSALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAM--GPEGVRVNAISAGPIRTLAASGIKDF------CEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIA--AM-------------
66 PsiBlast_CBE 85.0248%-106 - C1 -1DFG FABI_ECOLI A:[2-257] ----FLSGKRILVTGVASKLSIAYGIAQAMHR-EGAELAFTYQNDKLKGRVEEFAAQL--GS-----------D--IVLQCDVAEDASIDTMFAELGKVWPK-FDGFVHSIGFAPGDQLDGDYVNAV---TREGFKIAHDISSYSFVAMAKACRSML-NP---GSALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAM--GPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIA--AMNE-----------
17 PsiBlast_PDB 85.0148%-107 - C1 -4JQC FABI_ECOLI A:[21-278] --MGFLSGKRILVTGVASKLSIAYGIAQAMHR-EGAELAFTYQNDKLKGRVEEFAAQL--GS-----------D--IVLQCDVAEDASIDTMFAELGKVWPK-FDGFVHSIGFAPGDQLDGDYVN-AV--TREGFKIAHDISSYSFVAMAKACRSML-NP---GSALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAM--GPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIA--AMNE-----------
9 PsiBlast_PDB 84.7349%-108 - C1 -3PJD FABI_ECOLI A:[2-256] ---GFLSGKRILVTGVASKLSIAYGIAQAMHR-EGAELAFTYQNDKLKGRVEEFAAQL--GS-----------D--IVLQCDVAEDASIDTMFAELGKVWPK-FDGFVHSIAFAPGDQLDGDYVN-AV--TREGFKIAHDISSYSFVAMAKACRSML-NP---GSALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAM--GPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIA--AMNE-----------
50 PsiBlast_CBE 84.7248%-110 - C1 -4CV3 ? A:[2-256] ---GFLSGKRILVTGVASKLSIAYGIAQAMHR-EGAELAFTYQNDKLKGRVEEFAAQL--GS-----------D--IVLQCDVAEDASIDTMFAELGKVWPK-FDGFVHSIGFAPGDQLDGDYVN-AV--TREGFKIAHDISSYSFVAMAKACRSML-NP---GSALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAM--GPEGVRVNAISAGPI-----------------CEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIA--AMN------------
10 PsiBlast_PDB 84.6048%-107 - C1 -1C14 FABI_ECOLI A:[2-257] ---GFLSGKRILVTGVASKLSIAYGIAQAMHR-EGAELAFTYQNDKLKGRVEEFAAQL--GS-----------D--IVLQCDVAEDASIDTMFAELGKVWPK-FDGFVHSIGFAPGDQLDGDYVNAV---TREGFKIAHDISSYSFVAMAKACRSML-NP---GSALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAM--GPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIA--AMN------------
83 PsiBlast_CBE 84.5845%-104 * C1 *2WYW ? D:[6-258] -----LSGKKALVMGVTNQRSLGFAIAAKLKE-AGAEVALSYQAERLRPEAEKLAEAL--GG-----------A--LLFRADVTQDEELDALFAGVKEAFGG-LDYLVHAIAFAPREAMEGRYID-T---RRQDWLLALEVSAYSLVAVARRAEPLL-RE---GGGIVTLTYYASEKVVPKY--NVMAIAKAALEASVRYLAYEL--GPKGVRVNAISAGPVRTVAARSIPGFTKMYDRVAQTAPLRRN---ITQEEVGNLGLFLLS-PLASGITGEVVYVDAGYHIM--GME------------
79 PsiBlast_CBE 84.5751%-102 - C1 -3OIF FABI_BACSU A:[5-255] -----LEGRNIVVMGVANKRSIAWGIARSLHE-AGARLIFTYAGERLEKSVHELAGTLDRND-----------S--IILPCDVTNDAEIETCFASIKEQVGV-IHGIAHCIAFANKEELVGEYLN-T---NRDGFLLAHNISSYSLTAVVKAARPMM-TE---GGSIVTLTYLGGELVMPNY--NVMGVAKASLDASVKYLAADL--GKENIRVNSISAGPIRTLSAKGISDFNSILKDIEERAPLRRT---TTPEEVGDTAAFLFS-DMSRGITGENLHVDSGFHIT--AR-------------
49 PsiBlast_CBE 84.5748%-111 - C1 -4CV3 ? B:[2-256] ---GFLSGKRILVTGVASKLSIAYGIAQAMHR-EGAELAFTYQNDKLKGRVEEFAAQL--GS-----------D--IVLQCDVAEDASIDTMFAELGKVWPK-FDGFVHSIGFAPGDQLDGDYVN-AV--TREGFKIAHDISSYSFVAMAKACRSML-NP---GSALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAM--GPEGVRVNAISAGPI-----------------CEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIA--AMN------------
33 PsiBlast_CBE 84.5548%-104 - C1 -1MFP FABI_ECOLI B:[2-259] ---GFLSGKRILVTGVASKLSIAYGIAQAMHR-EGAELAFTYQNDKLKGRVEEFAAQL--GS-----------D--IVLQCDVAEDASIDTMFAELGKVWPK-FDGFVHSIGFAPGDQLDGDYVNAV---TREGFKIAHDISSYSFVAMAKACRSML-NP---GSALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAM--GPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIA--AMNEL----------
56 PsiBlast_CBE 84.5248%-107 - C1 -1QG6 FABI_ECOLI C:[2-257] ----FLSGKRILVTGVASKLSIAYGIAQAMHR-EGAELAFTYQNDKLKGRVEEFAAQL--GS-----------D--IVLQCDVAEDASIDTMFAELGKVWPK-FDGFVHSIGFAPGDQLDGDYVNAV---TREGFKIAHDISSYSFVAMAKACRSML-NP---GSALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAM--GPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIA--AMNE-----------
67 PsiBlast_CBE 84.4948%-107 - C1 -1D8A FABI_ECOLI B:[2-257] ----FLSGKRILVTGVASKLSIAYGIAQAMHR-EGAELAFTYQNDKLKGRVEEFAAQL--GS-----------D--IVLQCDVAEDASIDTMFAELGKVWPK-FDGFVHSIGFAPGDQLDGDYVNAV---TREGFKIAHDISSYSFVAMAKACRSML-NP---GSALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAM--GPEGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIA--AMNE-----------
52 PsiBlast_CBE 84.4748%-111 - C1 -4CV2 ? A:[2-256] ---GFLSGKRILVTGVASKLSIAYGIAQAMHR-EGAELAFTYQNDKLKGRVEEFAAQL--GS-----------D--IVLQCDVAEDASIDTMFAELGKVWPK-FDGFVHSIGFAPGDQLDGDYVN-AV--TREGFKIAHDISSYSFVAMAKACRSML-NP---GSALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAM--GPEGVRVNAISAGPI-------------------AVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFSIA--AMN------------
80 PsiBlast_CBE 84.4450%-105 - C1 -4ZJU ? A:[11-267] --QGLLAGKRFLIAGVASKLSIAYGIAQALHR-EGAELAFTYPNEKLKKRVDEFAEQF--GS-----------K--LVFPCDVAVDAEIDNAFAELAKHWDG-VDGVVHSIGFAPAHTLDGDFTDVT---DRDGFKIAHDISAYSFVAMARAAKPLLQAR---QGCLLTLTYQGSERVMPNY--NVMGMAKASLEAGVRYLASSL--GVDGIRVNAISAGPIRTLAASGIKSFRKMLDANEKVAPLKRN---VTIEEVGNAALFLCS-PWASGITGEILYVDAGFNTV--GMSQS----------