@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Wbm0677: (2015-12-03 )
MLVNNISYLYNNQDDFALNNINIKVKRGKVACLLGHSGCGKSTILKLIAGIENPKSGTIFINDKLVASSSTSIAIEHRNIGLIFQHSALFPHKTVVENVTFAIRSSSKKEKHLIALEILKLLNIAKYENMYPNALSGGQQQLVAIARVMAQNPDVVLLDEPFSNLDILLKCQIRQRILSLFRSKNIPVLMVTHDPQEALKVADFIYVMKNGRIIQSGISSDIYHRPKDDTLAKFFSELSSTLQLGEKFPLDGAFAVRK

Atome Classification :

(38 SA) ----.........10........20........30........40........50........60...---.....70-....-....--------80........90........100---.---.--..--.--.--.110.......120..-.....130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230...---....240.------......250......-----------------------------------------------------------------------------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) ----MLVNNISYLYNNQDDFALNNINIKVKRGKVACLLGHSGCGKSTILKLIAGIENPKSGTIFINDK---LVASSST-SIAI-EHRN--------IGLIFQHSALFPHKTVVENVTFA---I---R--SS--S--K--KEKHLIALEILKLLNI-AKYENMYPNALSGGQQQLVAIARVMAQNPDVVLLDEPFSNLDILLKCQIRQRILSLFRSKNIPVLMVTHDPQEALKVADFIYVMKNGRIIQSGISSDIYHRPKDDTLAKFF---SELSSTLQ------LGEKFPLDGAFAVRK-----------------------------------------------------------------------------
115 Fugue 82.4535%-134 - C1 -1Z47 ? A:[11-355] GSMTIEFVGVEKIYPGGAR-SVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGK---RV----T-DLPP-QKRN--------VGLVFQNYALFQHMTVYDNVSFG---L---REKRV--P--K--DEMDARVRELLRFMRL-ESYANRFPHELSGGQQQRVALARALAPRPQVLLFDEPFAAIDTQIRRELRTFVRQVHDEMGVTSVFVTHDQEEALEVADRVLVLHEGNVEQFGTPEEVYEKPGTLFVASFIGESNVWTRAVQNGRIEVAGAALPVDPAVSEGSEVAVVVRPKDVELQPASEREAHAQVVRSAFKGSYSACWIRTKDGEVWEVHVPSADRHRWSPGAWVHMNVTRWFIFPR
96 HHSearch 82.3239%-143 - C1 -1V43 - ? A:[13-244] ----VKLENLTKRFGN--FTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDR---DVTYLP-----P-KDRN--------ISMVFQ------HMTVYENIAFP---L-------K--KFPK--DEIDKRVRWAAELLQI-EELLNRYPAQLSGGQRQRVAVARAIVVEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKLKVTTIYVTHDQVEAMTMGDRIAVMNRGQLLQIGSPTEVYLRPNSVFVATFI---GAPEMNIL------EVSVGDGYLEGRGFR-----------------------------------------------------------------------------
100 HHSearch 79.4445%-134 - C1 -2IT1 - ? A:[4-234] ----IKLENIVKKFGN--FTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEK---DVTELP-----P-KDRN--------VGLVFQNWALYPHMTVYKNIAFP---L---E--LR--K--APREEIDKKVREVAKMLHI-DKLLNRYPWQLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKELGITTVYVTHDQAEALAMADRIAVIREGEILQVGTPDEVYYKPKYKFVGGFL---GNPPMNFV------EAKVEDGKLVITEKS-----------------------------------------------------------------------------
101 HHSearch 78.6540%-129 - C1 -2YYZ ? A:[4-227] ----IRVVNLKKYFGK--VKAVDGVSFEVKDGEFVALLGPSGCGKTTTLLMLAGIYKPTSGEIYFDDV---LVNDIP-----P-KYRE--------VGMVFQNYALYPHMTVFENIAFP---L---R--AR--RISK--DEVEKRVVEIARKLLI-DNLLDRKPTQLSGGQQQRVALARALVKQPKVLLFDEPLSNLDANLRMIMRAEIKHLQQELGITSVYVTHDQAEAMTMASRIAVFNQGKLVQYGTPDEVYDSPKNMFVASFI---GNPPTNFL------RDFSVSVENKQTILK-----------------------------------------------------------------------------
9 PsiBlast_PDB 78.1540%-143 - C1 -1V43 - ? A:[27-244] --------------------AVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIYFGDR---DV----T-YLPP-KDRN--------ISMVFQ------HMTVYENIAFPL------K--KF--P--K--DEIDKRVRWAAELLQI-EELLNRYPAQLSGGQRQRVAVARAIVVEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKLKVTTIYVTHDQVEAMTMGDRIAVMNRGQLLQIGSPTEVYLRPNSVFVATFI---GAPEMNIL------EVSVGDGYLEGRGFR-----------------------------------------------------------------------------
27 PsiBlast_CBE 78.0738%-136 - C1 -3FVQ FBPC_NEIG1 B:[15-241] ----------------QNTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGK---TIFSKNT-NLPV-RERR--------LGYLVQEGVLFPHLTVYRNIAYG---LGNGK--GR--T--A--QERQRIE-AMLELTGI-SELAGRYPHELSGGQQQRAALARALAPDPELILLDEPFSALDEQLRRQIREDMIAALRANGKSAVFVSHDREEALQYADRIAVMKQGRILQTASPHELYRQPADLDAALFI---GEGIVFPA------ALNADGTADCRLGRL-----------------------------------------------------------------------------
94 HHSearch 77.6536%-135 - C1 -1Z47 ? A:[15-248] ----IEFVGVEKIYPG-GARSVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGK---RVTDL-----PP-QKRN--------VGLVFQNYALFQHMTVYDNVSFG---L---R--EK--R--VPKDEMDARVRELLRFMRL-ESYANRFPHELSGGQQQRVALARALAPRPQVLLFDEPFAAIDTQIRRELRTFVRQVHDEMGVTSVFVTHDQEEALEVADRVLVLHEGNVEQFGTPEEVYEKPGTLFVASFI---GESNVWTR------AVQNGRIEVAGAALP-----------------------------------------------------------------------------
26 PsiBlast_CBE 76.2136%-128 - C1 -1OXU ? B:[4-246] ----IIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDR---LVASNGK-LIVPPEDRK--------IGMVFQTWALYPNLTAFENIAFP---L---T--NMKMS--K--EEIRKRVEEVAKILDI-HHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLI---GEINELEG------KVTNEGVVIGSLRFP-----------------------------------------------------------------------------
5 PsiBlast_PDB 76.1936%-129 - C1 -1OXU ? A:[4-246] ----IIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDR---LVASNGK-LIVPPEDRK--------IGMVFQTWALYPNLTAFENIAFP---L---T--NMKMS--K--EEIRKRVEEVAKILDI-HHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLI---GEINELEG------KVTNEGVVIGSLRFP-----------------------------------------------------------------------------
21 PsiBlast_CBE 76.0645%-138 - C1 -2IT1 ? B:[18-235] --------------------ALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEK---DV----T-ELPP-KDRN--------VGLVFQNWALYPHMTVYKNIAFP---LEL-R--KA--P--R--EEIDKKVREVAKMLHI-DKLLNRYPWQLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKELGITTVYVTHDQAEALAMADRIAVIREGEILQVGTPDEVYYKPKYKFVGGFL---GNPPMNFV------EAKVEDGKLVITEKS-----------------------------------------------------------------------------
23 PsiBlast_CBE 75.9236%-129 - C1 -1OXV ? D:[4-246] ----IIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDR---LVASNGK-LIVPPEDRK--------IGMVFQTWALYPNLTAFENIAFP---L---T--NMKMS--K--EEIRKRVEEVAKILDI-HHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLI---GEINELEG------KVTNEGVVIGSLRFP-----------------------------------------------------------------------------
11 PsiBlast_PDB 75.0538%-135 - C1 -3FVQ FBPC_NEIG1 A:[15-241] ----------------QNTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGK---TIFSKNT-NLPV-RERR--------LGYLVQEGVLFPHLTVYRNIAYG---LGNGK--GR--T--A--QERQRIE-AMLELTGI-SELAGRYPHELSGGQQQRAALARALAPDPELILLDEPFSALDEQLRRQIREDMIAALRANGKSAVFVSHDREEALQYADRIAVMKQGRILQTASPHELYRQPADLDAALFI---GEGIVFPA------ALNADGTADCRLGRL-----------------------------------------------------------------------------
7 PsiBlast_PDB 74.9535%-125 - C1 -1OXX ? K:[4-246] ----IIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDR---LVASNGK-LIVPPEDRK--------IGMVFQTWALYPNLTAFENIAFP---L---T--NMKMS--K--EEIRKRVEEVAKILDI-HHVLNHFPRELSGAQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLI---GEINELEG------KVTNEGVVIGSLRFP-----------------------------------------------------------------------------
24 PsiBlast_CBE 74.9336%-124 - C1 -1OXV ? B:[4-246] ----IIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDR---LVASNGK-LIVPPEDRK--------IGMVFQTWALYPNLTAFENIAFP---L---T--NMKMS--K--EEIRKRVEEVAKILDI-HHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLI---GEINELEG------KVTNEGVVIGSLRFP-----------------------------------------------------------------------------
95 HHSearch 74.7937%-133 - C1 -3FVQ FBPC_NEIG1 A:[5-233] ----LHIGHLSKSFQN--TPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGK---TIFSKNT-NLPV-RERR--------LGYLVQEGVLFPHLTVYRNIAYG---L---G--NG--KGRT--AQERQRIEAMLELTGI-SELAGRYPHELSGGQQQRAALARALAPDPELILLDEPFSALDEQLRRQIREDMIAALRANGKSAVFVSHDREEALQYADRIAVMKQGRILQTASPHELYRQPADLDAALFI---GEGIVFPA------ALNADGTADCRLGRL-----------------------------------------------------------------------------
97 HHSearch 74.7336%-128 - C1 -1OXX ? K:[4-242] ----IIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDR---LVASNGKLIVPP-EDRK--------IGMVFQTWALYPNLTAFENIAFP---L---T--NM--KMSK--EEIRKRVEEVAKILDI-HHVLNHFPRELSGAQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLI---GEINELEG------KVTNEGVVIGSLRFP-----------------------------------------------------------------------------
1 PsiBlast_PDB 74.3445%-136 - C1 -2IT1 - ? A:[18-235] --------------------ALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIYFDEK---DV----T-ELPP-KDRN--------VGLVFQNWALYPHMTVYKNIAFP---LEL-R--KA--P--R--EEIDKKVREVAKMLHI-DKLLNRYPWQLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKELGITTVYVTHDQAEALAMADRIAVIREGEILQVGTPDEVYYKPKYKFVGGFL---GNPPMNFV------EAKVEDGKLVITEKS-----------------------------------------------------------------------------
25 PsiBlast_CBE 73.8636%-127 - C1 -1OXU ? C:[4-246] ----IIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDR---LVASNGK-LIVPPEDRK--------IGMVFQTWALYPNLTAFENIAFP---L---T--NMKMS--K--EEIRKRVEEVAKILDI-HHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLI---GEINELEG------KVTNEGVVIGSLRFP-----------------------------------------------------------------------------
2 PsiBlast_PDB 73.7338%-138 - C1 -1Z47 ? A:[30-248] --------------------SVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVWIGGK---RV----T-DLPP-QKRN--------VGLVFQNYALFQHMTVYDNVSFG---L---R--EKRVP--K--DEMDARVRELLRFMRL-ESYANRFPHELSGGQQQRVALARALAPRPQVLLFDEPFAAIDTQIRRELRTFVRQVHDEMGVTSVFVTHDQEEALEVADRVLVLHEGNVEQFGTPEEVYEKPGTLFVASFI---GESNVWTR------AVQNGRIEVAGAALP-----------------------------------------------------------------------------
99 HHSearch 73.3537%-139 - C1 -3RLF MALK_ECOLI A:[4-236] ----VQLQNVTKAWGE--VVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEK---RMNDT-----PP-AERG--------VGMVFQSYALYPHLSVAENMSFG---L---K--LA--GAKK--EVINQRVNQVAEVLQL-AHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFI---GSPKMNFL------PVKVTATAIDQVQVE-----------------------------------------------------------------------------
50 PsiBlast_CBE 64.0533%-131 - C1 -4YMU ? J:[17-239] ---------------------LKGVTLKVNKGEVVVIIGPSGSGKSTLLRCINLLEEPTKGEVFIDGV---KINNGKV-NINK-VRQK--------VGMVFQHFNLFPHLTAIENITLAPVKV---K--KM--N--K--KEAEELAVDLLAKVGL-LDKKDQYPIKLSGGQKQRLAIARALAMQPEVMLFDEPTSALDPEMVKEVLN-VMKQLANEGMTMVVVTHEMGFAREVGDRVIFMDDGVIVEEGTPEEIFYRAKNERTREFL---SKIL------------------------------------------------------------------------------------------------------