@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Wbm0708: (2015-12-04 )
MNSFYEMGLPLLLAQALDKNSFSVPTPVQAQAIPLALKGKDILGSAQTGTGKTLAFAIPLIAKLLGEPNASTALVIVPTRELAQQVTNEIGKLLLKNSVLKIALLIGGEPIFRQLNQLQRRPRIVIGTPGRIIDHIERKTLITNNVSTLVLDEVDRMFDMGFGIQIEGIMKYLPKMRQNLMFSATLPGDIVKLAEKYSNQPERVSVENEATTSVKIKQEIIYASESEKYGKLVTQLYQRKGSIIVFVRTKQRADQLAYKLRKDNHSALAIHGDLKQRKRKRVINSFRRGHNQIMVATDVASRGLDIPHIQHVINYDAPESQANYIHRTGRTARAGAEGYALSFITSQDKKRLPTLTDKKGELNFDCNVQFKKCSSKKVSRRPSALKIKYGRKKTSTFKKKSTVLEKIY

Atome Classification :

(42 SA) .........10........20........30.......--.-40.........50........60......------------------.-----.--------70----.-----------------.-----.....-..80....---....90........-100.......110.......120--.-........130....-..-.140.-......150......-.-160........170--..----.--.-.-----.---..180.......190.......200.......210.......220.......230....--..--.240-.-.......250.......260.......270.......280.......290.......300.......310.......320.......330.......340......----.350.......360.......370.......380.......390.......400......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MNSFYEMGLPLLLAQALDKNSFSVPTPVQAQAIPLALK--G-K-DILGSAQTGTGKTLAFAIPLIAKLLGE------------------P-----N--------A-----S-----------------T-----ALVIV-PTRELAQQ---VTNEIGKLLLKNSV-LKIALLIGGEPIFRQLNQLQR----R-PRIVIGTPGRIIDHI-ER-KTLIT-NNVSTLVLDEVDRMF-D-MG-FGIQIEGIMK---YL----P--K-M-----R---QNLMFSATLPGDIVKLAEKYSNQPERVSVENEATTSVKIKQEIIYASESEKYGKLVTQL--YQ--RKG--S-IIVFVRTKQRADQLAYKLRKDNHSALAIHGDLKQRKRKRVINSFRRGHNQIMVATDVASRGLDIPHIQHVINYDAPESQANYIHRTGRTARAGAEGYALSFITSQD----KKRLPTLTDKKGELNFDCNVQFKKCSSKKVSRRPSALKIKYGRKKTSTFKKKSTVLEKIY
12 PsiBlast_PDB 91.1135%-109 - C3 -2I4I DDX3X_HUMAN A:[14-402] IESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKE--K-R-DLMACAQTGSGKTAAFLLPILSQIYSDG-----------------P-----G--------E-----ALRAMKENGRYGRRKQYPI-----SLVLA-PTRELAVQ---IYEEARKFSYRSRV--RPCVVYGGADIGQQIRDLER----G-CHLLVATPGRLVDMM-ER-GKIGL-DFCKYLVLDEADRML-D-MG-FEPQIRRIVEQDTMP----P--KGV-----R---HTMMFSATFPKEIQMLARDFLDEYIFLAVG----TSENITQKVVWVEESDKRSFLLDLL--NATGKDS--L-TLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGR--NLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAYEHHY---------------------------------
122 HHSearch 90.5337%-107 - C3 -2I4I DDX3X_HUMAN A:[15-396] -ESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKE--K-R-DLMACAQTGSGKTAAFLLPILSQIYSDGPGEALRAMKENGRYGRRK-----Q--------Y-----P-----------------I-----SLVLA-PTRELAVQ---IYEEARKFSYR-SR-VRPCVVYGGADIGQQIRDLER----G-CHLLVATPGRLVDMM-ER-GKIGL-DFCKYLVLDEADRML-D-MG-FEPQIRRIVE---QDTMPPK--G-V-----R---HTMMFSATFPKEIQMLARDFLDEYIFLAVG----TSENITQKVVWVEESDKRSFLLDLLNATG--KDS--L-TLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGR--NLGLATSFFNERN----INITKDLLDLLVEAKQEVPSWLENMAYEHHY-----------------------------
13 PsiBlast_PDB 88.1834% -96 - C3 -4PXA DDX3X_HUMAN A:[64-452] IESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKE--K-R-DLMACAQTGSGKTAAFLLPILSQIYSDG-----------------P-----G--------E-----ALRAMKENGRYGRRKQYPI-----SLVLA-PTRELAVQ---IYEEARKFSYRSRV--RPCVVYGGADIGQQIRDLER----G-CHLLVATPGRLVDMM-ER-GKIGL-DFCKYLVLDEADRML-V-MG-FEPQIRRIVEQDTMP----P--KGV-----R---HTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLL--NATGKDS--L-TLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAY-------------------------------------
21 PsiBlast_CBE 87.8636% -99 - C3 -2DB3 VASA1_DROME D:[55-412] IQHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVISS--G-R-DLMACAQTGSGKTAAFLLPILSKLLED------------------P-----H--------ELELGRP-----------------Q-----VVIVS-PTRELAIQ---IFNEARKFAFE-SY-LKIGIVYGGTSFRHQNECITR----G-CHVVIATPGRLLDFV-DR-TFITF-EDTRFVVLDEADRML-D-MG-FSEDMRRIMT---HV-------T-M-----RPEHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRSKLIEIL--SE--QAD--G-TIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSFFDPEK----DRAIAADLVKILEGSGQTVPDFLR------------------------------------
114 HHSearch 87.6138% -99 - C3 -2DB3 VASA1_DROME A:[56-408] -QHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVISS--G-R-DLMACAQTGSGKTAAFLLPILSKLLED------------------PHELELG--------R-----P-----------------Q-----VVIVS-PTRELAIQ---IFNEARKFAFE-SY-LKIGIVYGGTSFRHQNECITR----G-CHVVIATPGRLLDFV-DR-TFITF-EDTRFVVLDEADRML-D-MG-FSEDMRRIMT---HV----TMRP-E-----H---QTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRSKLIEIL--SE--QAD--G-TIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSFFDPEK----DRAIAADLVKILEGSGQTVPDFLR------------------------------------
22 PsiBlast_CBE 87.5136% -98 - C3 -2DB3 VASA1_DROME C:[55-412] IQHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVISS--G-R-DLMACAQTGSGKTAAFLLPILSKLLED------------------P-----H--------ELELGRP-----------------Q-----VVIVS-PTRELAIQ---IFNEARKFAFE-SY-LKIGIVYGGTSFRHQNECITR----G-CHVVIATPGRLLDFV-DR-TFITF-EDTRFVVLDEADRML-D-MG-FSEDMRRIMT---HV-------T-M-----RPEHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRSKLIEIL--SE--QAD--G-TIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSFFDPEK----DRAIAADLVKILEGSGQTVPDFLR------------------------------------
30 PsiBlast_CBE 87.3735%-122 - C3 -2VSX IF4A_YEAST B:[24-368] ---FDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIE--G-H-DVLAQAQSGTGKTGTFSIAALQRIDTS------------------V-----K--------A-----P-----------------Q-----ALMLA-PTRELALQ---IQKVVMALAFHMDI--KVHACIG----------L-R----D-AQIVVGTPGRVFDNI-QR-RRFRT-DKIKMFILDEADEML-S-SG-FKEQIYQIFT---LL----P--P-T-----T---QVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEEYKYECLTDL--YD--SISVTQ-AVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGR------KGVAINFVTNED----VGAMRELEKFYSTQIEELPSDIATL-----------------------------------
3 PsiBlast_PDB 87.3641% -95 - C3 -4D25 ? A:[67-407] ------------------KAGYRKPTPIQKNAIPIIMS--G-R-DLMGCAQTGSGKTAAFLVPIINMLLQD------------------P-----KDLISENGCA-----Q-----------------P-----QVIIVSPTRELTLQ---IFNEARKFSY-GSV-LKVAVAYGGTAVRHQGDNIAR----G-CHILVATPGRLHDFV-ER-NRVSF-GSVRFVVLDQADCML-D-MG-FMPSIEKMML---H-----P--T-MVETTKR---QTLMFSATFPEDIQHLAGRFLNNYLFVAVGIVGGASTDVEQIFIEVTKYEKRNSLKQLI--EE--NDG--KRILVFVETKRNADFIAAMLSEQQLLTSSIHGDRMQREREEALQNFKSGKHCILVATAVAARGLDIKNVDIVVNYDLPKSIDEYVHRIGRTGRVGNRGKAVSFYDSDQ----DLALVADLSKILRQADQSVPDFLK------------------------------------
2 PsiBlast_PDB 87.2236% -99 - C3 -2DB3 VASA1_DROME A:[55-412] IQHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVISS--G-R-DLMACAQTGSGKTAAFLLPILSKLLED------------------P-----H--------ELELGRP-----------------Q-----VVIVS-PTRELAIQ---IFNEARKFAFE-SY-LKIGIVYGGTSFRHQNECITR----G-CHVVIATPGRLLDFV-DR-TFITF-EDTRFVVLDEADRML-D-MG-FSEDMRRIMT---HV-------T-M-----RPEHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRSKLIEIL--SE--QAD--G-TIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSFFDPEK----DRAIAADLVKILEGSGQTVPDFLR------------------------------------
4 PsiBlast_PDB 87.2041% -96 - C3 -4D26 ? A:[67-407] ------------------KAGYRKPTPIQKNAIPIIMS--G-R-DLMGCAQTGSGKTAAFLVPIINMLLQD------------------P-----KDLISENGCA-----Q-----------------P-----QVIIVSPTRELTLQ---IFNEARKFSY-GSV-LKVAVAYGGTAVRHQGDNIAR----G-CHILVATPGRLHDFV-ER-NRVSF-GSVRFVVLDQADCML-D-MG-FMPSIEKMML---H-----P--T-MVETTKR---QTLMFSATFPEDIQHLAGRFLNNYLFVAVGIVGGASTDVEQIFIEVTKYEKRNSLKQLI--EE--NDG--KRILVFVETKRNADFIAAMLSEQQLLTSSIHGDRMQREREEALQNFKSGKHCILVATAVAARGLDIKNVDIVVNYDLPKSIDEYVHRIGRTGRVGNRGKAVSFYDSDQ----DLALVADLSKILRQADQSVPDFLK------------------------------------
31 PsiBlast_CBE 87.0835%-122 - C3 -2VSO IF4A_YEAST B:[24-368] ---FDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIE--G-H-DVLAQAQSGTGKTGTFSIAALQRIDTS------------------V-----K--------A-----P-----------------Q-----ALMLA-PTRELALQ---IQKVVMALAFHMDI--KVHACIG----------L-R----D-AQIVVGTPGRVFDNI-QR-RRFRT-DKIKMFILDEADEML-S-SG-FKEQIYQIFT---LL----P--P-T-----T---QVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEEYKYECLTDL--YD--SISVTQ-AVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGR------KGVAINFVTNED----VGAMRELEKFYSTQIEELPSDIATL-----------------------------------
20 PsiBlast_PDB 87.0335%-122 - C3 -2VSX IF4A_YEAST A:[24-368] ---FDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIE--G-H-DVLAQAQSGTGKTGTFSIAALQRIDTS------------------V-----K--------A-----P-----------------Q-----ALMLA-PTRELALQ---IQKVVMALAFHMDI--KVHACIG----------L-R----D-AQIVVGTPGRVFDNI-QR-RRFRT-DKIKMFILDEADEML-S-SG-FKEQIYQIFT---LL----P--P-T-----T---QVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEEYKYECLTDL--YD--SISVTQ-AVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGR------KGVAINFVTNED----VGAMRELEKFYSTQIEELPSDIATL-----------------------------------
19 PsiBlast_PDB 87.0035%-121 - C3 -2VSO IF4A_YEAST A:[24-368] ---FDDMELDENLLRGVFGYGFEEPSAIQQRAIMPIIE--G-H-DVLAQAQSGTGKTGTFSIAALQRIDTS------------------V-----K--------A-----P-----------------Q-----ALMLA-PTRELALQ---IQKVVMALAFHMDI--KVHACIG----------L-R----D-AQIVVGTPGRVFDNI-QR-RRFRT-DKIKMFILDEADEML-S-SG-FKEQIYQIFT---LL----P--P-T-----T---QVVLLSATMPNDVLEVTTKFMRNPVRILVKKDELTLEGIKQFYVNVEEEEYKYECLTDL--YD--SISVTQ-AVIFCNTRRKVEELTTKLRNDKFTVSAIYSDLPQQERDTIMKEFRSGSSRILISTDLLARGIDVQQVSLVINYDLPANKENYIHRIGR------KGVAINFVTNED----VGAMRELEKFYSTQIEELPSDIATL-----------------------------------
1 PsiBlast_PDB 86.9540%-108 - C3 -1HV8 H669_METJA A:[7-350] --NFNELNLSDNILNAIRNKGFEKPTDIQMKVIPLFLN--D-EYNIVAQARTGSGKTASFAIPLI-ELVNE------------------N-----N--------G-----I-----------------E-----AIILT-PTRELAIQ---VADEI-ESLKGNKN-LKIAKIYGGKAIYPQIKAL-K----N-ANIVVGTPGRILDHI-NR-GTLNL-KNVKYFILDEADEML-N-MG-FIKDVEKILN---AC----N--K-D-----K---RILLFSATMPREILNLAKKYMGDYSFI----KAKINANIEQSYVEVNENERFEALCRLL--KN--KEF--Y-GLVFCKTKRDTKELASMLRDIGFKAGAIHGDLSQSQREKVIRLFKQKKIRILIATDVMSRGIDVNDLNCVINYHLPQNPESYMHRIGRTGRAGKKGKAISIINRRE----YKKLRYIERAMKLKIKKLK-----------------------------------------
23 PsiBlast_CBE 86.9036%-100 - C3 -2DB3 VASA1_DROME B:[55-412] IQHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVISS--G-R-DLMACAQTGSGKTAAFLLPILSKLLED------------------P-----H--------ELELGRP-----------------Q-----VVIVS-PTRELAIQ---IFNEARKFAFE-SY-LKIGIVYGGTSFRHQNECITR----G-CHVVIATPGRLLDFV-DR-TFITF-EDTRFVVLDEADRML-D-MG-FSEDMRRIMT---HV-------T-M-----RPEHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRSKLIEIL--SE--QAD--G-TIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSFFDPEK----DRAIAADLVKILEGSGQTVPDFLR------------------------------------
124 HHSearch 86.6540%-108 - C3 -1HV8 H669_METJA A:[6-351] -MNFNELNLSDNILNAIRNKGFEKPTDIQMKVIPLFLN--DEY-NIVAQARTGSGKTASFAIPLIELVNEN------------------------N--------G-----I-----------------E-----AIILT-PTRELAIQ---VADEIESLKGN-KN-LKIAKIYGGKAIYPQI-KALK----N-ANIVVGTPGRILDHI-NR-GTLNL-KNVKYFILDEADEML-N-MG-FIKDVEKILN---AC----N--K-D-----K---RILLFSATMPREILNLAKKYMGDYSFIKAK----INANIEQSYVEVNENERFEALCRLL--KN--KEF--Y-GLVFCKTKRDTKELASMLRDIGFKAGAIHGDLSQSQREKVIRLFKQKKIRILIATDVMSRGIDVNDLNCVINYHLPQNPESYMHRIGRTGRAGKKGKAISIINRRE----YKKLRYIERAMKLKIKKLK-----------------------------------------
10 PsiBlast_PDB 83.5034%-100 - C3 -2J0S IF4A3_HUMAN A:[38-384] --TFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIK--G-R-DVIAQSQSGTGKTATFSISVLQCLDIQ------------------V-----R--------E-----T-----------------Q-----ALILA-PTRELAVQ---IQK--GLLALGDYMNVQCHACIGGTNVGEDIRKLDY----G-QHVVAGTPGRVFDMI-RR-RSLRT-RAIKMLVLDEADEML-N-KG-FKEQIYDVYR---YL----P--P-A-----T---QVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDL--YD--TLTITQ-AVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDD----IRILRDIEQYYSTQIDEMPMNVADLI----------------------------------
7 PsiBlast_PDB 83.2434% -96 - C3 -2XB2 IF4A3_HUMAN A:[39-385] --TFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIK--G-R-DVIAQSQSGTGKTATFSISVLQCLDIQ------------------V-----R--------E-----T-----------------Q-----ALILA-PTRELAVQ---IQK--GLLALGDYMNVQCHACIGGTNVGEDIRKLDY----G-QHVVAGTPGRVFDMI-RR-RSLRT-RAIKMLVLDEADEML-N-KG-FKEQIYDVYR---YL----P--P-A-----T---QVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDL--YD--TLTITQ-AVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDD----IRILRDIEQYYSTQIDEMPMNVADLI----------------------------------
6 PsiBlast_PDB 82.8034%-100 - C3 -3EX7 IF4A3_HUMAN C:[39-385] --TFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIK--G-R-DVIAQSQSGTGKTATFSISVLQCLDIQ------------------V-----R--------E-----T-----------------Q-----ALILA-PTRELAVQ---IQK--GLLALGDYMNVQCHACIGGTNVGEDIRKLDY----G-QHVVAGTPGRVFDMI-RR-RSLRT-RAIKMLVLDEADEML-N-KG-FKEQIYDVYR---YL----P--P-A-----T---QVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDL--YD--TLTITQ-AVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDD----IRILRDIEQYYSTQIDEMPMNVADLILE--------------------------------
25 PsiBlast_CBE 82.6134% -96 - C3 -2HYI IF4A3_HUMAN I:[39-385] --TFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIK--G-R-DVIAQSQSGTGKTATFSISVLQCLDIQ------------------V-----R--------E-----T-----------------Q-----ALILA-PTRELAVQ---IQK--GLLALGDYMNVQCHACIGGTNVGEDIRKLDY----G-QHVVAGTPGRVFDMI-RR-RSLRT-RAIKMLVLDEADEML-N-KG-FKEQIYDVYR---YL----P--P-A-----T---QVVLISATLPHEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDL--YD--TLTITQ-AVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKEFRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYGRKGVAINFVKNDD----IRILRDIEQYYSTQIDEMPMNVADLILE--------------------------------
51 PsiBlast_CBE 67.9838%-113 - C3 -3BER DDX47_HUMAN A:[44-249] --TFKDLGVTDVLCEACDQLGWTKPTKIQIEAIPLALQ--G-R-DIIGLAETGSGKTGAFALPILNALLET------------------P-----Q--------R-----L-----------------F-----ALVLT-PTRELAFQ---ISEQFEA--LGSSIGVQSAVIVGGIDSMSQSLALAK----K-PHIIIATPGRLIDHL-ENTKGFNL-RALKYLVMDEADRIL-N-MD-FETEVDKILK---VI----P--R-D-----R---KTFLFSATMTKKVQKLQRAALKNPVKCAVSS-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
74 PsiBlast_CBE 67.1933%-123 - C3 -4PX9 DDX3X_HUMAN A:[64-284] IESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKE--K-R-DLMACAQTGSGKTAAFLLPILSQIYSDG-----------------P-----G--------E-----ALRAMKENGRYGRRKQYPI-----SLVLA-PTRELAVQ---IYEEARKFSYRSRV--RPCVVYGGADIGQQIRDLER----G-CHLLVATPGRLVDMM-ER-GKIGL-DFCKYLVLDEADRML-D-MG-FEPQIRRIVEQDTMP----P--KGV-----R---HTMMFSATFPKEIQMLARDFLDEYIFLAVGR-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
73 PsiBlast_CBE 66.6633%-122 - C3 -4PX9 DDX3X_HUMAN B:[64-284] IESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKE--K-R-DLMACAQTGSGKTAAFLLPILSQIYSDG-----------------P-----G--------E-----ALRAMKENGRYGRRKQYPI-----SLVLA-PTRELAVQ---IYEEARKFSYRSRV--RPCVVYGGADIGQQIRDLER----G-CHLLVATPGRLVDMM-ER-GKIGL-DFCKYLVLDEADRML-D-MG-FEPQIRRIVEQDTMP----P--KGV-----R---HTMMFSATFPKEIQMLARDFLDEYIFLAVGR-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
72 PsiBlast_CBE 65.5533%-123 - C3 -4PX9 DDX3X_HUMAN C:[64-284] IESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKE--K-R-DLMACAQTGSGKTAAFLLPILSQIYSDG-----------------P-----G--------E-----ALRAMKENGRYGRRKQYPI-----SLVLA-PTRELAVQ---IYEEARKFSYRSRV--RPCVVYGGADIGQQIRDLER----G-CHLLVATPGRLVDMM-ER-GKIGL-DFCKYLVLDEADRML-D-MG-FEPQIRRIVEQDTMP----P--KGV-----R---HTMMFSATFPKEIQMLARDFLDEYIFLAVGR-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
57 PsiBlast_CBE 64.1142%-106 - C3 -2GXQ ? A:[14-205] --------------EALHGRGLTTPTPIQAAALPLALE--G-K-DLIGQARTGTGKTLAFALPIAERL--A------------------P-----S--------Q-----E-----------------RGRKPRALVLT-PTRELALQ---VASELTAV---APH-LKVVAVYGGTGYGKQKEALLR----G-ADAVVATPGRALDYL-RQ-GVLDL-SRVEVAVLDEADEML-S-MG-FEEEVEALLS---AT----P--P-S-----R---QTLLFSATLPSWAKRLAERYMKNPVLINVIK-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
56 PsiBlast_CBE 63.4342%-106 - C3 -2GXS ? A:[14-205] --------------EALHGRGLTTPTPIQAAALPLALE--G-K-DLIGQARTGTGKTLAFALPIAERL--A------------------P-----S--------Q-----E-----------------RGRKPRALVLT-PTRELALQ---VASELTAV---APH-LKVVAVYGGTGYGKQKEALLR----G-ADAVVATPGRALDYL-RQ-GVLDL-SRVEVAVLDEADEML-S-MG-FEEEVEALLS---AT----P--P-S-----R---QTLLFSATLPSWAKRLAERYMKNPVLINVIK-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
55 PsiBlast_CBE 63.3142%-101 - C3 -2GXS ? B:[14-205] --------------EALHGRGLTTPTPIQAAALPLALE--G-K-DLIGQARTGTGKTLAFALPIAERL--A------------------P-----S--------Q-----E-----------------RGRKPRALVLT-PTRELALQ---VASELTAV---APH-LKVVAVYGGTGYGKQKEALLR----G-ADAVVATPGRALDYL-RQ-GVLDL-SRVEVAVLDEADEML-S-MG-FEEEVEALLS---AT----P--P-S-----R---QTLLFSATLPSWAKRLAERYMKNPVLINVIK-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
92 PsiBlast_CBE 63.1431%-115 - C3 -3FMO DD19B_HUMAN B:[93-300] --SFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPP-Q-NLIAQSQSGTGKTAAFVLAMLSQVEPA------------------N-----K--------Y-----P-----------------Q-----CLCLS-PTYELALQTGKVIEQMGKFYPE----LKLAYAVRG-------NKLERGQKIS-EQIVIGTPGTVLDWC-SK-LKFIDPKKIKVFVLDEADVMIAT-QG-HQDQSIRIQR---ML----P--R-N-----C---QMLLFSATFEDSVWKFAQKVVPDPNVIKLKRE------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------