@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Wbm0739: (2015-12-04 )
MSRRVVVTGIGLITPLAADVENTWLKLINGKSGIKKISRFDASDLSCKVAGQVPLQHDNIEHCFNPLNYISEKDLKRTDRFIHYGIAAAIQAVDDSLILENQSINRERIGVAIGSGIGGLPSIQENVIIMQEKGPRRVSPFFVPASLINLISGHVSIKYEFTGPNDSAVTACATGAHAIINSARAIKLGEADVMIAGGSESALCRVGIAGFASMKALSTKFNDKPKEASRPWNEGRDGFVMGEGAGILVLEEYEHAKKRGAKIYAELTGYGLTGDAYHITAPHLEGRGALKAMQLALKSAQINPNQIGYINAHGTSTPLGDKIEVIAIKQLFDDYAYKIPISSTKSSIGHLLGAAGSVEAIFSILVLNNGIVPPTLNLHKPSEGCDLNFIPLKAQEHEIQYALSNSFGFGGTNASLVFGKCS

Atome Classification :

(53 SA) .........10........20........30....-------....--40.-------.......50...----.....60.-......-.70......---..80......----..90........100.......110.......120.......130.......140.......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280.......290.......300.......310.......320.......330......--.340.......350.......360.......370.......380--..-.....390-....-..-.400-.........410.......420
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MSRRVVVTGIGLITPLAADVENTWLKLINGKSGIK-------KISR--FDA-------SDLSCKVAGQVP----LQHDNIEH-CFNPLN-YISEKDLKR---TDRFIHYGIA----AAIQAVDDSLILENQSINRERIGVAIGSGIGGLPSIQENVIIMQEKGPRRVSPFFVPASLINLISGHVSIKYEFTGPNDSAVTACATGAHAIINSARAIKLGEADVMIAGGSESALCRVGIAGFASMKALSTKFNDKPKEASRPWNEGRDGFVMGEGAGILVLEEYEHAKKRGAKIYAELTGYGLTGDAYHITAPHLEGRGALKAMQLALKSAQINPNQIGYINAHGTSTPLGDKIEVIAIKQLFDDYAYK--IPISSTKSSIGHLLGAAGSVEAIFSILVLNNGIVPPTLNLHKPS--EG-CDLNFIPL-KAQE-HE-IQ---YALSNSFGFGGTNASLVFGKCS
106 HHSearch 97.7955% -75 - C3 -3KZU ? A:[9-427] -MRRVVITGLGLVSPLASGVEETWKRLLAGESGAR-------RVTE--FEV-------DDLACQIACRIPVGDGTNGT------FNPDL-HMDPKEQRK---VDPFIVYAVG----AADQALDDAGWHPENDEDQVRTGVLIGSGIGGIEGIVEAGYTLRDKGPRRISPFFIPGRLINLASGHVSIKHKLRGPNHSVVTACATGTHAIGDAARLIAFGDADVMVAGGTESPVSRISLAGFAACKALSTERNDDPTAASRPYDEDRDGFVMGEGAGIVVLEELEHALARGAKIYAEVIGYGMSGDAFHITAPTESGEGAQRCMVAALKRAGIVPDEIDYINAHGTSTM-ADTIELGAVERVVGEAAAK--ISMSSTKSSIGHLLGAAGAAEAVFSTLAIRDNIAPATLNLDNPA--AQ-TRIDLVPH-KPRE-RK-ID---VALSNSFGFGGTNASLVLRRYT
8 PsiBlast_PDB 97.6152% -79 - C3 -4JRM FABF_VIBCH D:[7-414] --RRVVVTGMGMLSPVGNTVESSWKALLAGQSGIV-------NIEH--FDT-------TNFSTRFAGLV------------K-GFDCEQ-YMSKKDARK---MDLFIQYGIA----AGIQALEDSGLEVNEE-NAARIGVAIGSGIGGLELIETGHQALIEKGPRKVSPFFVPSTIVNMIAGNLSIMRGLRGPNIAISTACTTGLHNIGHAARMIAYGDADAMVAGGAEKASTPLGMAGFGAAKALSTR-NDEPQKASRPWDKDRDGFVLGDGAGIMVLEEYEHAKARGAKIYAEVVGFGMSGDAYHMTSPSEDGSGGALAMEAAMRDAGVTGEQIGYVNAHGTSTPAGDVAEVKGIKRALGEAGTKQ-VLVSSTKSMTGHLLGAAGSVEAIITVMSLVDQMVPPTINLDNPE--EG-LGVDLVPH-VARK-VESME---YAMCNSFGFGGTNGSLIFKRM-
13 PsiBlast_PDB 97.6055% -75 - C3 -3KZU ? A:[10-425] --RRVVITGLGLVSPLASGVEETWKRLLAGESGAR-------RVTE--FEV-------DDLACQIACRIP----VG-DGTNG-TFNPDL-HMDPKEQRK---VDPFIVYAVG----AADQALDDAGWHPENDEDQVRTGVLIGSGIGGIEGIVEAGYTLRDKGPRRISPFFIPGRLINLASGHVSIKHKLRGPNHSVVTACATGTHAIGDAARLIAFGDADVMVAGGTESPVSRISLAGFAACKALSTERNDDPTAASRPYDEDRDGFVMGEGAGIVVLEELEHALARGAKIYAEVIGYGMSGDAFHITAPTESGEGAQRCMVAALKRAGIVPDEIDYINAHGTST-MADTIELGAVERVVGEAAAK--ISMSSTKSSIGHLLGAAGAAEAVFSTLAIRDNIAPATLNLDNPA--AQ-TRIDLVPH-KPRE-RK-ID---VALSNSFGFGGTNASLVLRRYT
7 PsiBlast_PDB 97.5552% -79 - C3 -4JRH FABF_VIBCH A:[7-414] --RRVVVTGMGMLSPVGNTVESSWKALLAGQSGIV-------NIEH--FDT-------TNFSTRFAGLV------------K-GFDCEQ-YMSKKDARK---MDLFIQYGIA----AGIQALEDSGLEVNEE-NAARIGVAIGSGIGGLELIETGHQALIEKGPRKVSPFFVPSTIVNMIAGNLSIMRGLRGPNIAISTACTTGLHNIGHAARMIAYGDADAMVAGGAEKASTPLGMAGFGAAKALSTR-NDEPQKASRPWDKDRDGFVLGDGAGIMVLEEYEHAKARGAKIYAEVVGFGMSGDAYHMTSPSEDGSGGALAMEAAMRDAGVTGEQIGYVNAHGTSTPAGDVAEVKGIKRALGEAGTKQ-VLVSSTKSMTGHLLGAAGSVEAIITVMSLVDQMVPPTINLDNPE--EG-LGVDLVPH-VARK-VESME---YAMCNSFGFGGTNGSLIFKRM-
14 PsiBlast_PDB 97.2954% -76 - C3 -2GFW - FABF_ECOLI A:[3-411] --RRVVVTGLGMLSPVGNTVESTWKALLAGQSGIS-------LIDH--FDT-------SAYATKFAGLV------------K-DFNCED-IISRKEQRK---MDAFIQYGIV----AGVQAMQDSG-LEITEENATRIGAAIGSGIGGLGLIEENHTSLMNGGPRKISPFFVPSTIVNMVAGHLTIMYGLRGPSISIATACTSGVHNIGHAARIIAYGDADVMVAGGAEKASTPLGVGGFGAARALSTR-NDNPQAASRPWDKERDGFVLGDGAGMLVLEEYEHAKKRGAKIYAELVGFGMSSDAYHMTSPPENGAGAALAMANALRDAGIEASQIGYVNAHGTSTPAGDKAEAQAVKTIFGEAASR--VLVSSTKSMTGHLLGAAGAVESIYSILALRDQAVPPTINLDNPD--EG-CDLDFVPH-EARQVSG-ME---YTLCNSFGFGGTNGSLIFKKI-
4 PsiBlast_PDB 97.1253% -78 - C3 -4JPF ? A:[26-433] --RRVVITGMGMLSPLGLDVPSSWEGILAGRSGIA-------PIEH--MDL-------SAYSTRFGGSV------------K-GFNVEE-YLSAKEARK---LDLFIQYGLA----ASFQAVRDS-GLEVTDANRERIGVSMGSGIGGLTNIENNCRSLFEQGPRRISPFFVPGSIINMVSGFLSIHLGLQGPNYALTTACTTGTHSIGMAARNIAYGEADVMVAGGSEMAACGLGLGGFGAARALSTR-NDEPTRASRPWDRDRDGFVLSDGSGALVLEELEHARARGARIYAELVGFGMSGDAFHMTAPPEDGAGAARCMKNALRDAGLDPRQVDYINAHGTSTPAGDIAEIAAVKSVFGEHAHA--LSMSSTKSMTGHLLGAAGAVEAIFSVLALRDQVAPPTINLDNPD--EG-CDLDLVAH-EAKP-RK-ID---VALSNSFGFGGTNGTLVFRRFA
28 PsiBlast_CBE 97.0152% -79 - C3 -4JRH FABF_VIBCH B:[7-414] --RRVVVTGMGMLSPVGNTVESSWKALLAGQSGIV-------NIEH--FDT-------TNFSTRFAGLV------------K-GFDCEQ-YMSKKDARK---MDLFIQYGIA----AGIQALEDSGLEVNEE-NAARIGVAIGSGIGGLELIETGHQALIEKGPRKVSPFFVPSTIVNMIAGNLSIMRGLRGPNIAISTACTTGLHNIGHAARMIAYGDADAMVAGGAEKASTPLGMAGFGAAKALSTR-NDEPQKASRPWDKDRDGFVLGDGAGIMVLEEYEHAKARGAKIYAEVVGFGMSGDAYHMTSPSEDGSGGALAMEAAMRDAGVTGEQIGYVNAHGTSTPAGDVAEVKGIKRALGEAGTKQ-VLVSSTKSMTGHLLGAAGSVEAIITVMSLVDQMVPPTINLDNPE--EG-LGVDLVPH-VARK-VESME---YAMCNSFGFGGTNGSLIFKRM-
23 PsiBlast_CBE 96.9453% -77 - C3 -4B7V ? B:[26-433] --RRVVITGMGMLSPLGLDVPSSWEGILAGRSGIA-------PIEH--MDL-------SAYSTRFGGSV------------K-GFNVEE-YLSAKEARK---LDLFIQYGLA----ASFQAVRDS-GLEVTDANRERIGVSMGSGIGGLTNIENNCRSLFEQGPRRISPFFVPGSIINMVSGFLSIHLGLQGPNYALTTACTTGTHSIGMAARNIAYGEADVMVAGGSEMAACGLGLGGFGAARALSTR-NDEPTRASRPWDRDRDGFVLSDGSGALVLEELEHARARGARIYAELVGFGMSGDAFHMTAPPEDGAGAARCMKNALRDAGLDPRQVDYINAHGTSTPAGDIAEIAAVKSVFGEHAHA--LSMSSTKSMTGHLLGAAGAVEAIFSVLALRDQVAPPTINLDNPD--EG-CDLDLVAH-EAKP-RK-ID---VALSNSFGFGGTNGTLVFRRFA
1 PsiBlast_PDB 96.9057% -79 - C3 -4QAV ? A:[4-410] --RRVVITGLGQVSPVGNTVAEAWDTLLAGKSGIG-------AITR--FDA-------SDINSRVAGEV------------R-GFDIGQ-YISAKEARR---MDVFIHYGIA----AALQAIADSGLDDVENLDKDRIGVNIGSGIGGLPSIEVTGKAVIEGGARKINPFFIPGSLINLISGHVTILKGYRGPSYGMVSACTTGAHAIGNSARLIKYGDADIMVAGGAEGAISTLGVGGFAAMKALSTR-NDDPATASRPWDKGRDGFVIGEGAGILVLEELEHAKKRGAKIYAEIVGFGMSSDAYHITAPNEEGP-AL-AVTRALKDAGINPEDVDYVNAHGTSTPLGDANETKALKRAFGEHAYK--TVVSSTKSMTGHLLGAAGGVEAVYSILAIHDGKIPPTINIFEQDVEAG-CDLDYCAN-EARD-AE-ID---VAISNSFGFGGTNGTLVFKRFK
43 PsiBlast_CBE 96.8355% -76 - C3 -3E60 ? A:[6-423] --RRVVITGLGLVSPLAGDVEYSWKRLLEGKSGVR-------RITE--FDV-------SDLSCQIAARIP----VG-DGTNG-TYNADL-HMESKEQRK---VDAFIVYAIA----AADQALADAEWFPKSDEDQICTGVLIGSGIGGIEGIVEAGYTLRDKGPRRISPFFIPGRLINLASGYVSIKYGLRGPNHSVVTACSTGAHAIGDAARLIALGDADVMLAGGTESPINRISLAGFSACRALSTCRNDDPERASRPYDVDRDGFVMGEGAAIVVLEELEHAKKRGARIYAEIIGYGLSGDAYHITAPSESGEGAQRSMMAALKRAQVNVSELDYINAHGTST-MADVIELAAVERVLGYYAPQ--VSMSSTKSSIGHLLGAAGAAEAIFCVLAIRDNIAPATLNLENPS--IE-TKIDLVPH-KPRE-RK-ID---TVLSNSFGFGGTNASLVMRRFS
16 PsiBlast_PDB 96.6954% -73 - C3 -1KAS - FABF_ECOLI A:[3-411] --RRVVVTGLGMLSPVGNTVESTWKALLAGQSGIS-------LIDH--FDT-------SAYATKFAGLV------------K-DFNCED-IISRKEQRK---MDAFIQYGIV----AGVQAMQDSG-LEITEENATRIGAAIGSGIGGLGLIEENHTSLMNGGPRKISPFFVPSTIVNMVAGHLTIMYGLRGPSISIATACTSGVHNIGHAARIIAYGDADVMVAGGAEKASTPLGVGGFGAARALSTR-NDNPQAASRPWDKERDGFVLGDGAGMLVLEEYEHAKKRGAKIYAELVGFGMSSDAYHMTSPPENGAGAALAMANALRDAGIEASQIGYVNAHGTSTPAGDKAEAQAVKTIFGEAASR--VLVSSTKSMTGHLLGAAGAVESIYSILALRDQAVPPTINLDNPD--EG-CDLDFVPH-EARQVSG-ME---YTLCNSFGFGGTNGSLIFKKI-
3 PsiBlast_PDB 96.6853% -76 - C3 -4B7V ? A:[26-433] --RRVVITGMGMLSPLGLDVPSSWEGILAGRSGIA-------PIEH--MDL-------SAYSTRFGGSV------------K-GFNVEE-YLSAKEARK---LDLFIQYGLA----ASFQAVRDS-GLEVTDANRERIGVSMGSGIGGLTNIENNCRSLFEQGPRRISPFFVPGSIINMVSGFLSIHLGLQGPNYALTTACTTGTHSIGMAARNIAYGEADVMVAGGSEMAACGLGLGGFGAARALSTR-NDEPTRASRPWDRDRDGFVLSDGSGALVLEELEHARARGARIYAELVGFGMSGDAFHMTAPPEDGAGAARCMKNALRDAGLDPRQVDYINAHGTSTPAGDIAEIAAVKSVFGEHAHA--LSMSSTKSMTGHLLGAAGAVEAIFSVLALRDQVAPPTINLDNPD--EG-CDLDLVAH-EAKP-RK-ID---VALSNSFGFGGTNGTLVFRRFA
21 PsiBlast_CBE 96.6157% -78 - C3 -4QAV ? B:[4-410] --RRVVITGLGQVSPVGNTVAEAWDTLLAGKSGIG-------AITR--FDA-------SDINSRVAGEV------------R-GFDIGQ-YISAKEARR---MDVFIHYGIA----AALQAIADSGLDDVENLDKDRIGVNIGSGIGGLPSIEVTGKAVIEGGARKINPFFIPGSLINLISGHVTILKGYRGPSYGMVSACTTGAHAIGNSARLIKYGDADIMVAGGAEGAISTLGVGGFAAMKALSTR-NDDPATASRPWDKGRDGFVIGEGAGILVLEELEHAKKRGAKIYAEIVGFGMSSDAYHITAPNEEGP-AL-AVTRALKDAGINPEDVDYVNAHGTSTPLGDANETKALKRAFGEHAYK--TVVSSTKSMTGHLLGAAGGVEAVYSILAIHDGKIPPTINIFEQDVEAG-CDLDYCAN-EARD-AE-ID---VAISNSFGFGGTNGTLVFKRFK
33 PsiBlast_CBE 96.4155% -74 - C3 -3KZU ? C:[10-425] --RRVVITGLGLVSPLASGVEETWKRLLAGESGAR-------RVTE--FEV-------DDLACQIACRIP----VG-DGTNG-TFNPDL-HMDPKEQRK---VDPFIVYAVG----AADQALDDAGWHPENDEDQVRTGVLIGSGIGGIEGIVEAGYTLRDKGPRRISPFFIPGRLINLASGHVSIKHKLRGPNHSVVTACATGTHAIGDAARLIAFGDADVMVAGGTESPVSRISLAGFAACKALSTERNDDPTAASRPYDEDRDGFVMGEGAGIVVLEELEHALARGAKIYAEVIGYGMSGDAFHITAPTESGEGAQRCMVAALKRAGIVPDEIDYINAHGTST-MADTIELGAVERVVGEAAAK--ISMSSTKSSIGHLLGAAGAAEAVFSTLAIRDNIAPATLNLDNPA--AQ-TRIDLVPH-KPRE-RK-ID---VALSNSFGFGGTNASLVLRRYT
26 PsiBlast_CBE 96.3952% -79 - C3 -4JRM FABF_VIBCH B:[7-414] --RRVVVTGMGMLSPVGNTVESSWKALLAGQSGIV-------NIEH--FDT-------TNFSTRFAGLV------------K-GFDCEQ-YMSKKDARK---MDLFIQYGIA----AGIQALEDSGLEVNEE-NAARIGVAIGSGIGGLELIETGHQALIEKGPRKVSPFFVPSTIVNMIAGNLSIMRGLRGPNIAISTACTTGLHNIGHAARMIAYGDADAMVAGGAEKASTPLGMAGFGAAKALSTR-NDEPQKASRPWDKDRDGFVLGDGAGIMVLEEYEHAKARGAKIYAEVVGFGMSGDAYHMTSPSEDGSGGALAMEAAMRDAGVTGEQIGYVNAHGTSTPAGDVAEVKGIKRALGEAGTKQ-VLVSSTKSMTGHLLGAAGSVEAIITVMSLVDQMVPPTINLDNPE--EG-LGVDLVPH-VARK-VESME---YAMCNSFGFGGTNGSLIFKRM-
6 PsiBlast_PDB 96.1453% -76 - C3 -4JB6 ? A:[4-411] --RRVVITGMGMLSPLGLDVPSSWEGILAGRSGIA-------PIEH--MDL-------SAYSTRFGGSV------------K-GFNVEE-YLSAKEARK---LDLFIQYGLA----ASFQAVRDS-GLEVTDANRERIGVSMGSGIGGLTNIENNCRSLFEQGPRRISPFFVPGSIINMVSGFLSIHLGLQGPNYALTTAQTTGTHSIGMAARNIAYGEADVMVAGGSEMAACGLGLGGFGAARALSTR-NDEPTRASRPWDRDRDGFVLSDGSGALVLEELEHARARGARIYAELVGFGMSGDAFHMTAPPEDGAGAARCMKNALRDAGLDPRQVDYINAHGTSTPAGDIAEIAAVKSVFGEHAHA--LSMSSTKSMTGHLLGAAGAVEAIFSVLALRDQVAPPTINLDNPD--EG-CDLDLVAH-EAKP-RK-ID---VALSNSFGFGGTNGTLVFRRFA
11 PsiBlast_PDB 95.9951% -77 - C3 -4LS8 FABF_BACSU A:[17-423] --KRVVVTGLGALSPLGNDVDTSWNNAINGVSGIG-------PITR--VDA-------EEYPAKVAAEL------------K-DFNVED-YMDKKEARK---MDRFTQYAVV----AAKMAVEDADLNITDEI-APRVGVWVGSGIGGLETLESQFEIFLTKGPRRVSPFFVPMMIPDMATGQISIALGAKGVNSCTVTACATGTNSIGDAFKVIQRGDADVMVTGGTEAPLTRMSFAGFSANKALST--NPDPKTASRPFDKNRDGFVMGEGAGIIVLEELEHALARGAKIYGEIVGYGSTGDAYHITAPAQDGEGGARAMQEAIKDAGIAPEEIDYINAHGTSTYYNDKYETMAIKTVFGEHAHK--LAVSSTKSMTGHLLGAAGGIEAIFSILAIKEGVIPPTINIQTPD--EE-CDLDYVPD-EARR-QE-LN---YVLSNSLGFGGHNATLIFKKYQ
9 PsiBlast_PDB 95.9551% -78 - C3 -4LS5 FABF_BACSU A:[17-423] --KRVVVTGLGALSPLGNDVDTSWNNAINGVSGIG-------PITR--VDA-------EEYPAKVAAEL------------K-DFNVED-YMDKKEARK---MDRFTQYAVV----AAKMAVEDADLNITDEI-APRVGVWVGSGIGGLETLESQFEIFLTKGPRRVSPFFVPMMIPDMATGQISIALGAKGVNSCTVTACATGTNSIGDAFKVIQRGDADVMVTGGTEAPLTRMSFAGFSANKALST--NPDPKTASRPFDKNRDGFVMGEGAGIIVLEELEHALARGAKIYGEIVGYGSTGDAYHITAPAQDGEGGARAMQEAIKDAGIAPEEIDYINAHGTSTYYNDKYETMAIKTVFGEHAHK--LAVSSTKSMTGHLLGAAGGIEAIFSILAIKEGVIPPTINIQTPD--EE-CDLDYVPD-EARR-QE-LN---YVLSNSLGFGGHNATLIFKKYQ
27 PsiBlast_CBE 95.8952% -79 - C3 -4JRM FABF_VIBCH A:[7-414] --RRVVVTGMGMLSPVGNTVESSWKALLAGQSGIV-------NIEH--FDT-------TNFSTRFAGLV------------K-GFDCEQ-YMSKKDARK---MDLFIQYGIA----AGIQALEDSGLEVNEE-NAARIGVAIGSGIGGLELIETGHQALIEKGPRKVSPFFVPSTIVNMIAGNLSIMRGLRGPNIAISTACTTGLHNIGHAARMIAYGDADAMVAGGAEKASTPLGMAGFGAAKALSTR-NDEPQKASRPWDKDRDGFVLGDGAGIMVLEEYEHAKARGAKIYAEVVGFGMSGDAYHMTSPSEDGSGGALAMEAAMRDAGVTGEQIGYVNAHGTSTPAGDVAEVKGIKRALGEAGTKQ-VLVSSTKSMTGHLLGAAGSVEAIITVMSLVDQMVPPTINLDNPE--EG-LGVDLVPH-VARK-VESME---YAMCNSFGFGGTNGSLIFKRM-
29 PsiBlast_CBE 95.8051% -76 - C3 -4LS8 FABF_BACSU B:[17-423] --KRVVVTGLGALSPLGNDVDTSWNNAINGVSGIG-------PITR--VDA-------EEYPAKVAAEL------------K-DFNVED-YMDKKEARK---MDRFTQYAVV----AAKMAVEDADLNITDEI-APRVGVWVGSGIGGLETLESQFEIFLTKGPRRVSPFFVPMMIPDMATGQISIALGAKGVNSCTVTACATGTNSIGDAFKVIQRGDADVMVTGGTEAPLTRMSFAGFSANKALST--NPDPKTASRPFDKNRDGFVMGEGAGIIVLEELEHALARGAKIYGEIVGYGSTGDAYHITAPAQDGEGGARAMQEAIKDAGIAPEEIDYINAHGTSTYYNDKYETMAIKTVFGEHAHK--LAVSSTKSMTGHLLGAAGGIEAIFSILAIKEGVIPPTINIQTPD--EE-CDLDYVPD-EARR-QE-LN---YVLSNSLGFGGHNATLIFKKYQ
22 PsiBlast_CBE 95.7757% -77 - C3 -4JGA ? B:[15-430] -NKRVVITGLGLVTPVGLNVNSSWKNIVDGVSGIK-------TITE--FDT-------SKLACKIAGLI--------DNSEKDGFKLEN-FTQADDINRLSKMDKFIHYGVA----AATEAVEDSGWLPDDEKSRDRTGLILGSGIGGLKMIEDTSIKLYQENNGKVSPFFIPASLINLLSGLVSIKYGFSGPNQTAVTACSTGAHAIGDAMRMIKHGYADVMIAGGAEAPVTPVGVAGFVAARALCTKYNDNPKKASRPWDKDRSGFVMGEGAGVVVLEEYEHALNRGAKVYGEVIGYGSTGDAYHMTAPHPEGRGAYRAMRDAMLDATITPDMIDYINAHGTSTTLGDGIELAAVQKLFLEANPK--VLMSSTKSSIGHLLGAAGSVEFIFSALAIRDQIAPPTLNLDTPM--DE-VNIDLVAL-KAKK-TK-ID---YVLSNSFGFGGTNASLVIKSIL
31 PsiBlast_CBE 95.6351% -77 - C3 -4LS5 FABF_BACSU B:[17-423] --KRVVVTGLGALSPLGNDVDTSWNNAINGVSGIG-------PITR--VDA-------EEYPAKVAAEL------------K-DFNVED-YMDKKEARK---MDRFTQYAVV----AAKMAVEDADLNITDEI-APRVGVWVGSGIGGLETLESQFEIFLTKGPRRVSPFFVPMMIPDMATGQISIALGAKGVNSCTVTACATGTNSIGDAFKVIQRGDADVMVTGGTEAPLTRMSFAGFSANKALST--NPDPKTASRPFDKNRDGFVMGEGAGIIVLEELEHALARGAKIYGEIVGYGSTGDAYHITAPAQDGEGGARAMQEAIKDAGIAPEEIDYINAHGTSTYYNDKYETMAIKTVFGEHAHK--LAVSSTKSMTGHLLGAAGGIEAIFSILAIKEGVIPPTINIQTPD--EE-CDLDYVPD-EARR-QE-LN---YVLSNSLGFGGHNATLIFKKYQ
20 PsiBlast_PDB 95.6253% -76 - C3 -3HO9 FABF_ECOLI A:[18-426] --RRVVVTGLGMLSPVGNTVESTWKALLAGQSGIS-------LIDH--FDT-------SAYATKFAGLV------------K-DFNCED-IISRKEQRK---MDAFIQYGIV----AGVQAMQDSG-LEITEENATRIGAAIGSGIGGLGLIEENHTSLMNGGPRKISPFFVPSTIVNMVAGHLTIMYGLRGPSISIATAATSGVHNIGHAARIIAYGDADVMVAGGAEKASTPLGVGGFGAARALSTR-NDNPQAASRPWDKERDGFVLGDGAGMLVLEEYEHAKKRGAKIYAELVGFGMSSDAYHMTSPPENGAGAALAMANALRDAGIEASQIGYVNAHGTSTPAGDKAEAQAVKTIFGEAASR--VLVSSTKSMTGHLLGAAGAVESIYSILALRDQAVPPTINLDNPD--EG-CDLDFVPH-EARQVSG-ME---YTLCNSFGFGGTNGSLIFKKI-
19 PsiBlast_PDB 95.4853% -75 - C3 -3HO2 FABF_ECOLI A:[18-426] --RRVVVTGLGMLSPVGNTVESTWKALLAGQSGIS-------LIDH--FDT-------SAYATKFAGLV------------K-DFNCED-IISRKEQRK---MDAFIQYGIV----AGVQAMQDSG-LEITEENATRIGAAIGSGIGGLGLIEENHTSLMNGGPRKISPFFVPSTIVNMVAGHLTIMYGLRGPSISIATAATSGVHNIGHAARIIAYGDADVMVAGGAEKASTPLGVGGFGAARALSTR-NDNPQAASRPWDKERDGFVLGDGAGMLVLEEYEHAKKRGAKIYAELVGFGMSSDAYHMTSPPENGAGAALAMANALRDAGIEASQIGYVNAHGTSTPAGDKAEAQAVKTIFGEAASR--VLVSSTKSMTGHLLGAAGAVESIYSILALRDQAVPPTINLDNPD--EG-CDLDFVPH-EARQVSG-ME---YTLCNSFGFGGTNGSLIFKKI-
40 PsiBlast_CBE 95.4553% -75 - C3 -3G11 FABF_ECOLI A:[18-426] --RRVVVTGLGMLSPVGNTVESTWKALLAGQSGIS-------LIDH--FDT-------SAYATKFAGLV------------K-DFNCED-IISRKEQRK---MDAFIQYGIV----AGVQAMQDSG-LEITEENATRIGAAIGSGIGGLGLIEENHTSLMNGGPRKISPFFVPSTIVNMVAGHLTIMYGLRGPSISIATAQTSGVHNIGHAARIIAYGDADVMVAGGAEKASTPLGVGGFGAARALSTR-NDNPQAASRPWDKERDGFVLGDGAGMLVLEEYEHAKKRGAKIYAELVGFGMSSDAYHMTSPPENGAGAALAMANALRDAGIEASQIGYVNAHGTSTPAGDKAEAQAVKTIFGEAASR--VLVSSTKSMTGHLLGAAGAVESIYSILALRDQAVPPTINLDNPD--EG-CDLDFVPH-EARQVSG-ME---YTLCNSFGFGGTNGSLIFKKI-
44 PsiBlast_CBE 95.4353% -75 - C3 -2GFX FABF_ECOLI A:[18-426] --RRVVVTGLGMLSPVGNTVESTWKALLAGQSGIS-------LIDH--FDT-------SAYATKFAGLV------------K-DFNCED-IISRKEQRK---MDAFIQYGIV----AGVQAMQDSG-LEITEENATRIGAAIGSGIGGLGLIEENHTSLMNGGPRKISPFFVPSTIVNMVAGHLTIMYGLRGPSISIATAQTSGVHNIGHAARIIAYGDADVMVAGGAEKASTPLGVGGFGAARALSTR-NDNPQAASRPWDKERDGFVLGDGAGMLVLEEYEHAKKRGAKIYAELVGFGMSSDAYHMTSPPENGAGAALAMANALRDAGIEASQIGYVNAHGTSTPAGDKAEAQAVKTIFGEAASR--VLVSSTKSMTGHLLGAAGAVESIYSILALRDQAVPPTINLDNPD--EG-CDLDFVPH-EARQVSG-ME---YTLCNSFGFGGTNGSLIFKKI-
34 PsiBlast_CBE 95.2855% -72 - C3 -3KZU ? B:[10-425] --RRVVITGLGLVSPLASGVEETWKRLLAGESGAR-------RVTE--FEV-------DDLACQIACRIP----VG-DGTNG-TFNPDL-HMDPKEQRK---VDPFIVYAVG----AADQALDDAGWHPENDEDQVRTGVLIGSGIGGIEGIVEAGYTLRDKGPRRISPFFIPGRLINLASGHVSIKHKLRGPNHSVVTACATGTHAIGDAARLIAFGDADVMVAGGTESPVSRISLAGFAACKALSTERNDDPTAASRPYDEDRDGFVMGEGAGIVVLEELEHALARGAKIYAEVIGYGMSGDAFHITAPTESGEGAQRCMVAALKRAGIVPDEIDYINAHGTST-MADTIELGAVERVVGEAAAK--ISMSSTKSSIGHLLGAAGAAEAVFSTLAIRDNIAPATLNLDNPA--AQ-TRIDLVPH-KPRE-RK-ID---VALSNSFGFGGTNASLVLRRYT