@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : SA0016: (2016-03-11 )
MSSIVVVGTQWGDEGKGKITDFLAEQSDVIARFSGGNNAGHTIQFGGETYKLHLVPSGIFYKDKLAVIGNGVVVDPVALLKELDGLNERGIPTSNLRISNRAQVILPYHLAQDEYEERLRGDNKIGTTKKGIGPAYVDKVQRIGIRMADLLEKETFERLLKSNIEYKQAYFKGMFNETCPSFDDIFEEYYAAGQRLKEFVTDTSKILDDAFVADEKVLFEGAQGVMLDIDHGTYPFVTSSNPIAGNVTVGTGVGPTFVSKVIGVCKAYTSRVGDGPFPTELFDEDGHHIREVGREYGTTTGRPRRVGWFDSVVLRHSRRVSGITDLSINSIDVLTGLDTVKICTAYELDGKEITEYPANLDQLKRCKPIFEELPGWTEDVTSVRTLEELPENARKYLERISELCNVQISIFSVGPDREQTNLLKELW

Atome Classification :

(42 SA) .........10........20........30........40....-.-...50........60........70........80........90---.--.----..-....100.......110.....--..120--.........130.......140.......150-----.......160.......170....--...180.-..---....190.......200.......210...-.------.....220.......230.......240.......250.......260.......270.......280.......290.......300.......310.......320.......330.......340....-.-.--.350..--..---....360.......370.......380.......390.......400.......410.......420.....--
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MSSIVVVGTQWGDEGKGKITDFLAEQSDVIARFSGGNNAGHTIQF-G-GETYKLHLVPSGIFYKDKLAVIGNGVVVDPVALLKELDGLNERGI---P--T----SN-LRISNRAQVILPYHLAQDEYEE--RLR----GDNKIGTTKKGIGPAYVDKVQRIGIRMADLLE-----KETFERLLKSNIEYKQAYFKGMFN--ETCPSFD-DI---FEEYYAAGQRLKEFVTDTSKILDDA--FVA-D------EKVLFEGAQGVMLDIDHGTYPFVTSSNPIAGNVTVGTGVGPTFVSKVIGVCKAYTSRVGDGPFPTELFDEDGHHIREVGREYGTTTGRPRRVGWFDSVVLRHSRRVSGITDLSINSIDVLTGLDTVKICTAY-E-L--DGK-EI--TE---YPANLDQLKRCKPIFEELPGWTEDVTSVRTLEELPENARKYLERISELCNVQISIFSVGPDREQTNLLKELW--
2 PsiBlast_PDB 94.4870% -79 - C3 -4M9D PURA_BACAN A:[11-426] -------GTQWGDEGKGKITDFLSEHAEVVARYQGGNNAGHTIVF-G-GVKYKLHLIPSGIFYKEKICVIGNGLVVDPKALLEELKYLHDRGV---S--T----DN-LRVSNRAHVILPYHLKQDELEE--ASK----GDNKIGTTKKGIGPAYMDKAARIGIRMADLLD-----REAFKEKLEQNLAQKNRLFEKMYD--TEGFSVD-EI---FEEYFEYGQQIAQYVCDTSVVLNDA--LDN-N------HRVLFEGAQGVMLDIDHGTYPFVTSSNPIAGGVTVGTGVGPAKVTRVVGVCKAYTSRVGDGPFPTELHDEIGHQIREVGREYGTTTGRPRRVGWFDSVVVRHARRVSGLTDLSLNSIDVLTGIPTLKICVAY-K-C--DGK-VI--DE---VPANLNILAKCEPVCEELPGWTEDITGVRSLDELPENARKYVERVSELTGIQLSMFSVGPDRNQTNIV------
1 PsiBlast_PDB 93.7370% -87 - C3 -4M0G - PURA_BACAN A:[11-430] -------GTQWGDEGKGKITDFLSEHAEVVARYQGGNN-GHTIVF-----KYKLHLIPSGIFYKEKICVIGNGLVVDPKALLEELKYLHDRGV---S--T----DN-LRVSNRAHVILPYHLKQDELEE--ASK----GD-----TKKGIGPAYMDKAARIGIRMADLLD-----REAFKEKLEQNLAQKNRLFEKMYD--TEGFSVD-EI---FEEYFEYGQQIAQYVCDTSVVLNDA--LDN-N------HRVLFEGAQGVMLDIDHGTYPFVTSSNPIAGGVTVGTGVGPAKVTRVVGVCKAYTSRVGDGPFPTELHDEIGHQIREVGREYGTTTGRPRRVGWFDSVVVRHARRVSGLTDLSLNSIDVLTGIPTLKICVAY-K-C--DGK-VI--DE---VPANLNILAKCEPVCEELPGWTEDITGVRSLDELPENARKYVERVSELTGIQLSMFSVGPDRNQTNIVRNVY--
4 PsiBlast_PDB 85.3146% -66 - C3 -1CH8 PURA_ECOLI A:[2-427] -NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVI-N-GEKTVLHLIPSGILRENVTSIIGNGVVLSPAALMKEMKELEDRGI---P--VR---ER-LLLSEACPLILDYHVALDNARE--KAR----GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFD-----KETFAEKLKEVMEYHNFQLVNYYK--AEAVDYQ-KV---LDDTMAVADILTSMVVDVSDLLDQA--RQR-G------DFVMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFGATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAY-R-MP-DGR-EV--TT---TPLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPDRTETMILRD----
16 PsiBlast_PDB 85.2346% -70 - C3 -1CG1 PURA_ECOLI A:[2-427] -NNVVVLGTQWGDEGQGKIVDLLTERAKYVVRYQGGHNAGHTLVI-N-GEKTVLHLIPSGILRENVTSIIGNGVVLSPAALMKEMKELEDRGI---P--VR---ER-LLLSEACPLILDYHVALDNARE--KAR----GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFD-----KETFAEKLKEVMEYHNFQLVNYYK--AEAVDYQ-KV---LDDTMAVADILTSMVVDVSDLLDQA--RQR-G------DFVMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFGATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAY-R-MP-DGR-EV--TT---TPLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPDRTETMILRD----
54 Fugue 85.0747% -74 * C3 *1QF5 PURA_ECOLI A:[1-431] GNNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVI-N-GEKTVLHLIPSGILRENVTSIIGNGVVLSPAALMKEMKELEDRGI---P--V----RERLLLSEACPLILDYHVALDNARE--KAR----GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFD-----KETFAEKLKEVMEYHNFQLVNYYKAEAV--DYQ-KV---LDDTMAVADILTSMVVDVSDLLDQA--RQR-G------DFVMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFGATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAY-R-MP-DGR-EV--TT---TPLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPDRTETMILRDPFDA
8 PsiBlast_PDB 84.9946% -67 - C3 -2GCQ PURA_ECOLI A:[2-427] -NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVI-N-GEKTVLHLIPSGILRENVTSIIGNGVVLSPAALMKEMKELEDRGI---P--VR---ER-LLLSEACPLILDYHVALDNARE--KAR----GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFD-----KETFAEKLKEVMEYHNFQLVNYYK--AEAVDYQ-KV---LDDTMAVADILTSMVVDVSDLLDQA--RQR-G------DFVMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFGATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAY-R-MP-DGR-EV--TT---TPLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPDRTETMILRD----
11 PsiBlast_PDB 84.7346% -76 - C3 -1ADE - PURA_ECOLI A:[2-427] -NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVI-N-GEKTVLHLIPSGILRENVTSIIGNGVVLSPAALMKEMKELEDRGI---P--VR---ER-LLLSEACPLILDYHVALDNARE--KAR----GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFD-----KETFAEKLKEVMEYHNFQLVNYYK--AEAVDYQ-KV---LDDTMAVADILTSMVVDVSDLLDQA--RQR-G------DFVMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFGATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAY-R-MP-DGR-EV--TT---TPLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPDRTETMILRD----
55 Fugue 84.6346% -78 - C3 -1ADE - PURA_ECOLI A:[1-431] GNNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVI-N-GEKTVLHLIPSGILRENVTSIIGNGVVLSPAALMKEMKELEDRGI---P--V----RERLLLSEACPLILDYHVALDNARE--KAR----GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFD-----KETFAEKLKEVMEYHNFQLVNYYK--AEAVDYQ-KV---LDDTMAVADILTSMVVDVSDLLDQA--RQR-G------DFVMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFGATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAY-R-MP-DGR-EV--TT---TPLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPDRTETMILRDPFDA
7 PsiBlast_PDB 84.5546% -68 - C3 -1CIB PURA_ECOLI A:[2-427] -NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVI-N-GEKTVLHLIPSGILRENVTSIIGNGVVLSPAALMKEMKELEDRGI---P--VR---ER-LLLSEACPLILDYHVALDNARE--KAR----GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFD-----KETFAEKLKEVMEYHNFQLVNYYK--AEAVDYQ-KV---LDDTMAVADILTSMVVDVSDLLDQA--RQR-G------DFVMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFGATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAY-R-MP-DGR-EV--TT---TPLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPDRTETMILRD----
6 PsiBlast_PDB 84.5046% -71 - C3 -1QF5 PURA_ECOLI A:[2-427] -NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVI-N-GEKTVLHLIPSGILRENVTSIIGNGVVLSPAALMKEMKELEDRGI---P--VR---ER-LLLSEACPLILDYHVALDNARE--KAR----GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFD-----KETFAEKLKEVMEYHNFQLVNYYK--AEAVDYQ-KV---LDDTMAVADILTSMVVDVSDLLDQA--RQR-G------DFVMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFGATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAY-R-MP-DGR-EV--TT---TPLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPDRTETMILRD----
3 PsiBlast_PDB 84.4346% -66 - C3 -1CG0 PURA_ECOLI A:[2-427] -NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVI-N-GEKTVLHLIPSGILRENVTSIIGNGVVLSPAALMKEMKELEDRGI---P--VR---ER-LLLSEACPLILDYHVALDNARE--KAR----GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFD-----KETFAEKLKEVMEYHNFQLVNYYK--AEAVDYQ-KV---LDDTMAVADILTSMVVDVSDLLDQA--RQR-G------DFVMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFGATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAY-R-MP-DGR-EV--TT---TPLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPDRTETMILRD----
10 PsiBlast_PDB 84.3446% -71 - C3 -1SOO PURA_ECOLI A:[2-427] -NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVI-N-GEKTVLHLIPSGILRENVTSIIGNGVVLSPAALMKEMKELEDRGI---P--VR---ER-LLLSEACPLILDYHVALDNARE--KAR----GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFD-----KETFAEKLKEVMEYHNFQLVNYYK--AEAVDYQ-KV---LDDTMAVADILTSMVVDVSDLLDQA--RQR-G------DFVMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFGATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAY-R-MP-DGR-EV--TT---TPLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPDRTETMILRD----
18 PsiBlast_PDB 84.3246% -68 - C3 -1CG3 PURA_ECOLI A:[2-427] -NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVI-N-GEKTVLHLIPSGILRENVTSIIGNGVVLSPAALMKEMKELEDRGI---P--VR---ER-LLLSEACPLILDYHVALDNARE--KAR----GAKAIGTTGRGIGPAYEDKVALRGLRVGDLFD-----KETFAEKLKEVMEYHNFQLVNYYK--AEAVDYQ-KV---LDDTMAVADILTSMVVDVSDLLDQA--RQR-G------DFVMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFGATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAY-R-MP-DGR-EV--TT---TPLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPDRTETMILRD----
13 PsiBlast_PDB 84.3046% -68 - C3 -1KJX PURA_ECOLI A:[3-428] -NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVI-N-GEKTVLHLIPSGILRENVTSIIGNGVVLSPAALMKEMKELEDRGI---P--VR---ER-LLLSEACPLILDYHVALDNARE--KAR----GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFD-----KETFAEKLKEVMEYHNFQLVNYYK--AEAVDYQ-KV---LDDTMAVADILTSMVVDVSDLLDQA--RQR-G------DFVMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFGATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAY-R-MP-DGR-EV--TT---TPLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPDRTETMILRD----
17 PsiBlast_PDB 84.2846% -75 - C3 -3HID PURA_YERPE A:[4-428] --NVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLVI-N-GEKTVLHLIPSGILRENVISIIGNGVVLAPDALMKEMTELEARGV---P--VR---ER-LLLSEACPLILPYHVALDNARE--KAR------------GRGIGPAYEDKVARRGLRVSDLFN-----KETFAIKLKEIVEYHNFQLVHYYK--EAAVDYQ-KV---LDDVLAIADILTAMVVDVSELLDNA--RKQ-G------ELIMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGLGPRYVDYVLGIVKAYSTRVGAGPFPTELNDETGEFLRKQGNEYGATTGRSRRTGWLDIVAVRRAVQINSLSGFCMTKLDVLDGLKEVKLCVGY-R-MP-DGR-EV--DT---TPLAAEGWEGIEPIYETMPGWSETTFGVKEHSKLPQAALNYIQRVEELTGVPIDIISTGPDRDETMILRD----
15 PsiBlast_PDB 84.2346% -67 - C3 -1KKF PURA_ECOLI A:[3-428] -NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVI-N-GEKTVLHLIPSGILRENVTSIIGNGVVLSPAALMKEMKELEDRGI---P--VR---ER-LLLSEACPLILDYHVALDNARE--KAR----GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFD-----KETFAEKLKEVMEYHNFQLVNYYK--AEAVDYQ-KV---LDDTMAVADILTSMVVDVSDLLDQA--RQR-G------DFVMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFGATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAY-R-MP-DGR-EV--TT---TPLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPDRTETMILRD----
19 PsiBlast_PDB 84.1346% -68 - C3 -1CG4 PURA_ECOLI A:[2-427] -NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVI-N-GEKTVLHLIPSGILRENVTSIIGNGVVLSPAALMKEMKELEDRGI---P--VR---ER-LLLSEACPLILDYHVALDNARE--KAR----GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFD-----KETFAEKLKEVMEYHNFQLVNYYK--AEAVDYQ-KV---LDDTMAVADILTSMVVDVSDLLDQA--RQR-G------DFVMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFGATTGLRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAY-R-MP-DGR-EV--TT---TPLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPDRTETMILRD----
14 PsiBlast_PDB 83.8546% -68 - C3 -1KKB PURA_ECOLI A:[3-428] -NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVI-N-GEKTVLHLIPSGILRENVTSIIGNGVVLSPAALMKEMKELEDRGI---P--VR---ER-LLLSEACPLILDYHVALDNARE--KAR----GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFD-----KETFAEKLKEVMEYHNFQLVNYYK--AEAVDYQ-KV---LDDTMAVADILTSMVVDVSDLLDQA--RQR-G------DFVMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFGATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAY-R-MP-DGR-EV--TT---TPLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPDRTETMILRD----
9 PsiBlast_PDB 83.8546% -69 - C3 -1SON PURA_ECOLI A:[2-427] -NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVI-N-GEKTVLHLIPSGILRENVTSIIGNGVVLSPAALMKEMKELEDRGI---P--VR---ER-LLLSEACPLILDYHVALDNARE--KAR----GAKAIGTTGRGIGPAYEDKVARRGLRVGDLFD-----KETFAEKLKEVMEYHNFQLVNYYK--AEAVDYQ-KV---LDDTMAVADILTSMVVDVSDLLDQA--RQR-G------DFVMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFGATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAY-R-MP-DGR-EV--TT---TPLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPDRTETMILRD----
42 HHSearch 83.8046% -74 - C3 -3HID PURA_YERPE A:[2-430] GKNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLVI-N-GEKTVLHLIPSGILRENVISIIGNGVVLAPDALMKEMTELEARGV---P--VR---ER-LLLSEACPLILPYHVALDNARE--KAR------------GRGIGPAYEDKVARRGLRVSDLFN-----KETFAIKLKEIVEYHNFQLVHYYK--EAAVDYQ-KV---LDDVLAIADILTAMVVDVSELLDNA--RKQ-G------ELIMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGLGPRYVDYVLGIVKAYSTRVGAGPFPTELNDETGEFLRKQGNEYGATTGRSRRTGWLDIVAVRRAVQINSLSGFCMTKLDVLDGLKEVKLCVGY-R-MP-DGR-EV--DT---TPLAAEGWEGIEPIYETMPGWSETTFGVKEHSKLPQAALNYIQRVEELTGVPIDIISTGPDRDETMILRDPF--