@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : SA1259: (2016-03-23 )
MTLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRNVVLTSDTSFNVEGVDVIHSIEDIYQLPGHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRKK

Atome Classification :

(70 SA) .........10........20..-.-.....30......------------------------..40........50.---.......60........70-.........80.....----.------..---90........100..--.....110.......120.......130.......140.......150.......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MTLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLFEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRKK
41 PsiBlast_CBE 98.57100%-152 - C6 -3SH2 DYR_STAAU B:[1-157] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLFEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
14 PsiBlast_PDB 98.40100%-147 - C6 -3FYV DYR_STAAU X:[1-158] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLFEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRKK
12 PsiBlast_PDB 98.18100%-152 - C6 -4LAH DYR_STAAU X:[2-158] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLFEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
16 PsiBlast_PDB 98.01100%-152 - C6 -3FRD DYR_STAAU X:[1-157] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLFEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
42 PsiBlast_CBE 97.94100%-151 - C6 -3SH2 DYR_STAAU A:[1-157] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLFEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
20 PsiBlast_PDB 97.93100%-151 - C6 -3SR5 DYR_STAAU X:[1-157] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLFEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
15 PsiBlast_PDB 97.89100%-146 - C6 -3FYW DYR_STAAU X:[1-158] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLFEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRKK
7 PsiBlast_PDB 97.80100%-154 - C6 -3SRS DYR_STAAU X:[2-158] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLFEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
18 PsiBlast_PDB 97.73100%-152 - C6 -3FRF DYR_STAAU X:[1-158] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLFEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRKK
11 PsiBlast_PDB 97.55100%-150 - C6 -4LAG DYR_STAAU X:[2-158] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLFEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
9 PsiBlast_PDB 97.51100%-153 - C6 -3SRW DYR_STAAU X:[2-158] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLFEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
10 PsiBlast_PDB 97.48100%-150 - C6 -4LAE DYR_STAAU X:[2-158] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLFEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
17 PsiBlast_PDB 97.45100%-149 - C6 -3FRE DYR_STAAU X:[1-157] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLFEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
21 PsiBlast_CBE 97.3599%-149 - C6 -3FY9 DYR_STAAU X:[1-157] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLYEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
13 PsiBlast_PDB 97.30100%-151 - C6 -4LEK DYR_STAAU X:[2-158] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLFEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
1 PsiBlast_PDB 97.30100%-146 - C6 -4FGG DYR_STAAU A:[1-159] MTLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLFEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRKK
8 PsiBlast_PDB 97.25100%-153 - C6 -3SRU DYR_STAAU X:[2-158] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLFEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
4 PsiBlast_PDB 97.12100%-151 - C6 -3SQY DYR_STAAU X:[2-158] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLFEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
5 PsiBlast_PDB 97.09100%-150 - C6 -3SRQ DYR_STAAU X:[2-158] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLFEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
30 PsiBlast_CBE 97.05100%-153 - C6 -3FQC ? A:[1-157] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLFEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
22 PsiBlast_CBE 97.0199%-149 - C6 -3FY8 DYR_STAAU X:[1-157] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLYEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
6 PsiBlast_PDB 97.00100%-153 - C6 -3SRR DYR_STAAU X:[2-158] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLFEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
19 PsiBlast_PDB 96.8999%-151 - C6 -4Q67 ? A:[2-158] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLYEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
23 PsiBlast_CBE 96.8899%-154 - C6 -3FRB DYR_STAAU X:[1-157] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLYEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
29 PsiBlast_CBE 96.86100%-150 - C6 -3FQC ? B:[1-157] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLFEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
31 PsiBlast_CBE 96.85100%-150 - C6 -3FQ0 ? A:[1-157] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLFEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
36 PsiBlast_CBE 96.8499%-151 - C6 -3FQO ? A:[1-157] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLYEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
27 PsiBlast_CBE 96.69100%-148 - C6 -4TU5 ? X:[1-157] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLFEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
25 PsiBlast_CBE 96.6498%-152 - C6 -4Q6A ? A:[2-158] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHLKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLYEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
32 PsiBlast_CBE 96.48100%-146 - C6 -3F0S ? X:[1-157] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLFEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
24 PsiBlast_CBE 96.2599%-148 - C6 -3FRA DYR_STAAU X:[1-157] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLYEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
43 PsiBlast_CBE 96.12100%-145 - C6 -3SGY DYR_STAAU B:[1-157] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLFEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
38 PsiBlast_CBE 96.1299%-148 - C6 -3F0X ? X:[1-157] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLYEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
33 PsiBlast_CBE 96.05100%-148 - C6 -3F0Q ? X:[1-157] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLFEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
44 PsiBlast_CBE 95.91100%-145 - C6 -3SGY DYR_STAAU A:[1-157] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLFEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
39 PsiBlast_CBE 95.9099%-149 - C6 -3F0V ? X:[1-157] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLYEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
37 PsiBlast_CBE 95.7899%-144 - C6 -3FQF ? A:[1-157] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLYEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
40 PsiBlast_CBE 95.7399%-148 - C6 -3F0U ? X:[1-157] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLYEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
28 PsiBlast_CBE 95.62100%-149 - C6 -3FQZ ? A:[1-157] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLFEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
35 PsiBlast_CBE 95.4999%-145 - C6 -3FQV ? A:[1-157] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLYEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
26 PsiBlast_CBE 95.47100%-143 - C6 -4XEC ? X:[1-157] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLFEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
34 PsiBlast_CBE 95.20100%-149 - C6 -3F0B ? X:[1-157] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLFEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
46 PsiBlast_CBE 95.1798%-152 - C6 -3LG4 DYR_STAAU A:[2-158] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHYKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIIGGQTLFEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
47 PsiBlast_CBE 95.0198%-148 - C6 -3I8A DYR_STAAU X:[1-157] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKNVKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIFGGQTLYEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
45 PsiBlast_CBE 94.6298%-152 - C6 -3LG4 DYR_STAAU B:[2-158] -TLSILVAHDLQRVIGFENQLPW-H-LPNDLKHYKKLST------------------------GHTLVMGRKTFESIG---KPLPNRRNVVLTSDTSFN--VEGVDVIHSIEDIYQL----P------GH---VFIIGGQTLFEEMID--KVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK-
48 PsiBlast_CBE 91.4581%-141 - C6 -2W9S DYRA_STAAU F:[2-158] -TLSIIVAHDKQRVIGYQNQLPW-H-LPNDLKHIKQLTT------------------------GNTLVMARKTFESIG---KPLPNRRNVVLTNQASFH--HEGVDVINSLDEIKEL----S------GH---VFIFGGQTLYEAMID--QVDDMYITVIDGKFQGDTFFPPYTFEDWEVESSVEGQLDEKNTIPHTFLHLVRR-
49 PsiBlast_CBE 91.2981%-142 - C6 -2W9S DYRA_STAAU E:[2-158] -TLSIIVAHDKQRVIGYQNQLPW-H-LPNDLKHIKQLTT------------------------GNTLVMARKTFESIG---KPLPNRRNVVLTNQASFH--HEGVDVINSLDEIKEL----S------GH---VFIFGGQTLYEAMID--QVDDMYITVIDGKFQGDTFFPPYTFEDWEVESSVEGQLDEKNTIPHTFLHLVRR-
53 PsiBlast_CBE 91.1281%-140 - C6 -2W9S DYRA_STAAU A:[2-158] -TLSIIVAHDKQRVIGYQNQLPW-H-LPNDLKHIKQLTT------------------------GNTLVMARKTFESIG---KPLPNRRNVVLTNQASFH--HEGVDVINSLDEIKEL----S------GH---VFIFGGQTLYEAMID--QVDDMYITVIDGKFQGDTFFPPYTFEDWEVESSVEGQLDEKNTIPHTFLHLVRR-
50 PsiBlast_CBE 90.7681%-140 - C6 -2W9S DYRA_STAAU D:[2-158] -TLSIIVAHDKQRVIGYQNQLPW-H-LPNDLKHIKQLTT------------------------GNTLVMARKTFESIG---KPLPNRRNVVLTNQASFH--HEGVDVINSLDEIKEL----S------GH---VFIFGGQTLYEAMID--QVDDMYITVIDGKFQGDTFFPPYTFEDWEVESSVEGQLDEKNTIPHTFLHLVRR-
51 PsiBlast_CBE 90.7181%-139 - C6 -2W9S DYRA_STAAU C:[2-158] -TLSIIVAHDKQRVIGYQNQLPW-H-LPNDLKHIKQLTT------------------------GNTLVMARKTFESIG---KPLPNRRNVVLTNQASFH--HEGVDVINSLDEIKEL----S------GH---VFIFGGQTLYEAMID--QVDDMYITVIDGKFQGDTFFPPYTFEDWEVESSVEGQLDEKNTIPHTFLHLVRR-
52 PsiBlast_CBE 90.5281%-141 - C6 -2W9S DYRA_STAAU B:[2-158] -TLSIIVAHDKQRVIGYQNQLPW-H-LPNDLKHIKQLTT------------------------GNTLVMARKTFESIG---KPLPNRRNVVLTNQASFH--HEGVDVINSLDEIKEL----S------GH---VFIFGGQTLYEAMID--QVDDMYITVIDGKFQGDTFFPPYTFEDWEVESSVEGQLDEKNTIPHTFLHLVRR-
60 PsiBlast_CBE 79.7744%-134 - C6 -3JWC ? B:[7-166] MRVSFMVAMDENRVIGKDNNLPW-R-LPSELQYVKKTTM------------------------GHPLIMGRKNYEAIG---RPLPGRRNIIVTRNEGYH--VEGCEVAHSVEEVFEL----C------KNEEEIFIFGGAQIFDLFLP--YVDKLYITKIHHAFEGDTFFPEMDMTNWKEVFVEKGLTDEKN--PYTYYYHVYEK
57 PsiBlast_CBE 79.4044%-128 - C6 -3JWK ? A:[7-166] MRVSFMVAMDENRVIGKDNNLPW-R-LPSELQYVKKTTM------------------------GHPLIMGRKNYEAIG---RPLPGRRNIIVTRNEGYH--VEGCEVAHSVEEVFEL----C------KNEEEIFIFGGAQIFDLFLP--YVDKLYITKIHHAFEGDTFFPEMDMTNWKEVFVEKGLTDEKN--PYTYYYHVYEK
69 PsiBlast_CBE 79.3543%-129 - C6 -3JVX ? A:[7-166] MRVSFMVAMDENRVIGKDNNLPW-R-LPSELQYVKKTTM------------------------GHPLIMGRKNYEAIG---RPLPGRRNIIVTRNEGYH--VEGCEVAHSVEEVFEL----C------KNEEEIFIFGGAQIYDLFLP--YVDKLYITKIHHAFEGDTFFPEMDMTNWKEVFVEKGLTDEKN--PYTYYYHVYEK
113 HHSearch 79.2343%-133 * C6 *3S9U ? A:[4-165] MRVSFMVAMDENRVIGKDNNLPW-R-LPSELQYVKKTTM------------------------GHPLIMGRKNYEAIG---RPLPGRRNIIVTRNEGYH--VEGCEVAHSVEEVFEL----CKNE---EE---IFIFGGAQIYDLFLP--YVDKLYITKIHHAFEGDTFFPEMDMTNWKEVFVEKGLTDEKNPYTYYYHVYEKQQ
62 PsiBlast_CBE 79.1644%-127 - C6 -3JW5 ? B:[7-166] MRVSFMVAMDENRVIGKDNNLPW-R-LPSELQYVKKTTM------------------------GHPLIMGRKNYEAIG---RPLPGRRNIIVTRNEGYH--VEGCEVAHSVEEVFEL----C------KNEEEIFIFGGAQIFDLFLP--YVDKLYITKIHHAFEGDTFFPEMDMTNWKEVFVEKGLTDEKN--PYTYYYHVYEK
56 PsiBlast_CBE 79.1144%-128 - C6 -3JWK ? B:[7-166] MRVSFMVAMDENRVIGKDNNLPW-R-LPSELQYVKKTTM------------------------GHPLIMGRKNYEAIG---RPLPGRRNIIVTRNEGYH--VEGCEVAHSVEEVFEL----C------KNEEEIFIFGGAQIFDLFLP--YVDKLYITKIHHAFEGDTFFPEMDMTNWKEVFVEKGLTDEKN--PYTYYYHVYEK
59 PsiBlast_CBE 78.9944%-133 - C6 -3JWF ? A:[7-166] MRVSFMVAMDENRVIGKDNNLPW-R-LPSELQYVKKTTM------------------------GHPLIMGRKNYEAIG---RPLPGRRNIIVTRNEGYH--VEGCEVAHSVEEVFEL----C------KNEEEIFIFGGAQIFDLFLP--YVDKLYITKIHHAFEGDTFFPEMDMTNWKEVFVEKGLTDEKN--PYTYYYHVYEK
112 HHSearch 78.9143%-140 - C6 -