@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : SA2124: (2016-04-01 )
MLKSINHICFSVRNLNDSIHFYRDILLGKLLLTGKKTAYFELAGLWIALNEEKDIPRNEIHFSYTHIAFTIDDSEFKYWHQRLKDNNVNILEGRVRDIRDRQSIYFTDPDGHKLELHTGTLENRLNYYKEAKPHMTFYK

Atome Classification :

(36 SA) .........10........20.....-...30......------..40........50........60........70........80........90........100.......110.......120.......130.-......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MLKSINHICFSVRNLNDSIHFYRDIL-LGKLLLTGKKT------AYFELAGLWIALNEEKDIPRNEIHFSYTHIAFTIDDSEFKYWHQRLKDNNVNILEGRVRDIRDRQSIYFTDPDGHKLELHTGTLENRLNYYKEAKP-HMTFYK
22 PsiBlast_CBE 93.82100%-136 - C1 -4NB1 FOSB_STAAN B:[8-145] MLKSINHICFSVRNLNDSIHFYRDIL-LGKLLLTGKKT------AYFELAGLWIALNEEK----------YTHIAFTIDDSEFKYWHQRLKDNNVNILEGRVRDIRDRQSIYFTDPDGHKLELHTGTLENRLNYY------HMTFY-
21 PsiBlast_CBE 92.97100%-135 - C1 -4NB2 FOSB_STAAN B:[8-145] MLKSINHICFSVRNLNDSIHFYRDIL-LGKLLLTGKKT------AYFELAGLWIALNEEK---------SYTHIAFTIDDSEFKYWHQRLKDNNVNILEGRVRDIRDRQSIYFTDPDGHKLELHTGTLENRLNYY-------MTFY-
23 PsiBlast_CBE 91.38100%-131 - C1 -4NB0 FOSB_STAAN B:[8-144] -LKSINHICFSVRNLNDSIHFYRDIL-LGKLLLTGKKT------AYFELAGLWIALNEEK---------SYTHIAFTIDDSEFKYWHQRLKDNNVNILEGRVRDIRDRQSIYFTDPDGHKLELHTGTLENRLNYYK------MTFY-
1 PsiBlast_PDB 90.71100%-147 - C1 -4NB1 FOSB_STAAN A:[8-146] MLKSINHICFSVRNLNDSIHFYRDIL-LGKLLLTGKKT------AYFELAGLWIALNEE--------HFSYTHIAFTIDDSEFKYWHQRLKDNNVNILE---------QSIYFTDPDGHKLELHTGTLENRLNY---AKP-HMTFYK
7 PsiBlast_PDB 84.9363%-116 - C1 -4JH4 FOSB_BACC1 A:[1-138] MLNGINHLCFSVSNLEDSIEFYEKVL-EGELLVRGRKL------AYFNICGVWVALNEEIHIPRNEIYQSYTHIAFSVEQKDFESLLQRLEENDVHILKGRERDVRDCESIYFVDPDGHKFEFHSGTLQDRLNYYREDKP-HMTFY-
10 PsiBlast_PDB 84.6763%-116 - C1 -4JH1 FOSB_BACC1 A:[1-138] MLNGINHLCFSVSNLEDSIEFYEKVL-EGELLVRGRKL------AYFNICGVWVALNEEIHIPRNEIYQSYTHIAFSVEQKDFESLLQRLEENDVHILKGRERDVRDCESIYFVDPDGHKFEFHSGTLQDRLNYYREDKP-HMTFY-
5 PsiBlast_PDB 84.5863%-117 - C1 -4JH6 FOSB_BACC1 A:[1-138] MLNGINHLCFSVSNLEDSIEFYEKVL-EGELLVRGRKL------AYFNICGVWVALNEEIHIPRNEIYQSYTHIAFSVEQKDFESLLQRLEENDVHILKGRERDVRDCESIYFVDPDGHKFEFHSGTLQDRLNYYREDKP-HMTFY-
4 PsiBlast_PDB 84.3763%-118 - C1 -4JH7 FOSB_BACC1 A:[1-138] MLNGINHLCFSVSNLEDSIEFYEKVL-EGELLVRGRKL------AYFNICGVWVALNEEIHIPRNEIYQSYTHIAFSVEQKDFESLLQRLEENDVHILKGRERDVRDCESIYFVDPDGHKFEFHSGTLQDRLNYYREDKP-HMTFY-
3 PsiBlast_PDB 84.3463%-112 - C1 -4JH8 FOSB_BACC1 A:[1-138] MLNGINHLCFSVSNLEDSIEFYEKVL-EGELLVRGRKL------AYFNICGVWVALNEEIHIPRNEIYQSYTHIAFSVEQKDFESLLQRLEENDVHILKGRERDVRDCESIYFVDPDGHKFEFHSGTLQDRLNYYREDKP-HMTFY-
30 PsiBlast_CBE 83.9763%-119 - C1 -4JH3 FOSB_BACC1 B:[1-138] MLNGINHLCFSVSNLEDSIEFYEKVL-EGELLVRGRKL------AYFNICGVWVALNEEIHIPRNEIYQSYTHIAFSVEQKDFESLLQRLEENDVHILKGRERDVRDCESIYFVDPDGHKFEFHSGTLQDRLNYYREDKP-HMTFY-
33 PsiBlast_CBE 83.9465%-104 - C1 -4JD1 FOSB2_BACAN B:[2-139] MLQGINHICFSVSNLEKSIEFYQKIL-QAKLLVKGRKL------AYFDLNGLWIALNVEEDIPRNEIKQSYTHMAFTVTNEALDHLKEVLIQNDVNILPGRERDERDQRSLYFTDPDGHKFEFHTGTLQNRLEYYKEDKK-HMTFY-
11 PsiBlast_PDB 83.8665%-113 - C1 -4JD1 FOSB2_BACAN A:[2-139] MLQGINHICFSVSNLEKSIEFYQKIL-QAKLLVKGRKL------AYFDLNGLWIALNVEEDIPRNEIKQSYTHMAFTVTNEALDHLKEVLIQNDVNILPGRERDERDQRSLYFTDPDGHKFEFHTGTLQNRLEYYKEDKK-HMTFY-
9 PsiBlast_PDB 83.8063%-115 - C1 -4JH2 FOSB_BACC1 A:[1-138] MLNGINHLCFSVSNLEDSIEFYEKVL-EGELLVRGRKL------AYFNICGVWVALNEEIHIPRNEIYQSYTHIAFSVEQKDFESLLQRLEENDVHILKGRERDVRDCESIYFVDPDGHKFEFHSGTLQDRLNYYREDKP-HMTFY-
27 PsiBlast_CBE 83.6363%-111 - C1 -4JH6 FOSB_BACC1 B:[1-138] MLNGINHLCFSVSNLEDSIEFYEKVL-EGELLVRGRKL------AYFNICGVWVALNEEIHIPRNEIYQSYTHIAFSVEQKDFESLLQRLEENDVHILKGRERDVRDCESIYFVDPDGHKFEFHSGTLQDRLNYYREDKP-HMTFY-
2 PsiBlast_PDB 83.6163%-114 - C1 -4JH9 FOSB_BACC1 A:[1-138] MLNGINHLCFSVSNLEDSIEFYEKVL-EGELLVRGRKL------AYFNICGVWVALNEEIHIPRNEIYQSYTHIAFSVEQKDFESLLQRLEENDVHILKGRERDVRDCESIYFVDPDGHKFEFHSGTLQDRLNYYREDKP-HMTFY-
29 PsiBlast_CBE 83.3363%-112 - C1 -4JH4 FOSB_BACC1 B:[1-138] MLNGINHLCFSVSNLEDSIEFYEKVL-EGELLVRGRKL------AYFNICGVWVALNEEIHIPRNEIYQSYTHIAFSVEQKDFESLLQRLEENDVHILKGRERDVRDCESIYFVDPDGHKFEFHSGTLQDRLNYYREDKP-HMTFY-
8 PsiBlast_PDB 83.2263%-111 - C1 -4JH3 FOSB_BACC1 A:[1-138] MLNGINHLCFSVSNLEDSIEFYEKVL-EGELLVRGRKL------AYFNICGVWVALNEEIHIPRNEIYQSYTHIAFSVEQKDFESLLQRLEENDVHILKGRERDVRDCESIYFVDPDGHKFEFHSGTLQDRLNYYREDKP-HMTFY-
28 PsiBlast_CBE 83.1963%-110 - C1 -4JH5 FOSB_BACC1 B:[1-138] MLNGINHLCFSVSNLEDSIEFYEKVL-EGELLVRGRKL------AYFNICGVWVALNEEIHIPRNEIYQSYTHIAFSVEQKDFESLLQRLEENDVHILKGRERDVRDCESIYFVDPDGHKFEFHSGTLQDRLNYYREDKP-HMTFY-
6 PsiBlast_PDB 83.0663%-112 - C1 -4JH5 FOSB_BACC1 A:[1-138] MLNGINHLCFSVSNLEDSIEFYEKVL-EGELLVRGRKL------AYFNICGVWVALNEEIHIPRNEIYQSYTHIAFSVEQKDFESLLQRLEENDVHILKGRERDVRDCESIYFVDPDGHKFEFHSGTLQDRLNYYREDKP-HMTFY-
12 PsiBlast_PDB 83.0564%-112 - C1 -4IR0 FOSB2_BACAN A:[3-139] -LQGINHICFSVSNLEKSIEFYQKIL-QAKLLVKGRKL------AYFDLNGLWIALNVEEDIPRNEIKQSYTHMAFTVTNEALDHLKEVLIQNDVNILPGRERDERDQRSLYFTDPDGHKFEFHTGTLQNRLEYYKEDKK-HMTFY-
25 PsiBlast_CBE 82.9763%-108 - C1 -4JH8 FOSB_BACC1 B:[1-138] MLNGINHLCFSVSNLEDSIEFYEKVL-EGELLVRGRKL------AYFNICGVWVALNEEIHIPRNEIYQSYTHIAFSVEQKDFESLLQRLEENDVHILKGRERDVRDCESIYFVDPDGHKFEFHSGTLQDRLNYYREDKP-HMTFY-
24 PsiBlast_CBE 82.8963%-112 - C1 -4JH9 FOSB_BACC1 B:[1-138] MLNGINHLCFSVSNLEDSIEFYEKVL-EGELLVRGRKL------AYFNICGVWVALNEEIHIPRNEIYQSYTHIAFSVEQKDFESLLQRLEENDVHILKGRERDVRDCESIYFVDPDGHKFEFHSGTLQDRLNYYREDKP-HMTFY-
31 PsiBlast_CBE 82.6063%-108 - C1 -4JH2 FOSB_BACC1 B:[1-138] MLNGINHLCFSVSNLEDSIEFYEKVL-EGELLVRGRKL------AYFNICGVWVALNEEIHIPRNEIYQSYTHIAFSVEQKDFESLLQRLEENDVHILKGRERDVRDCESIYFVDPDGHKFEFHSGTLQDRLNYYREDKP-HMTFY-
26 PsiBlast_CBE 82.5363%-110 - C1 -4JH7 FOSB_BACC1 B:[1-138] MLNGINHLCFSVSNLEDSIEFYEKVL-EGELLVRGRKL------AYFNICGVWVALNEEIHIPRNEIYQSYTHIAFSVEQKDFESLLQRLEENDVHILKGRERDVRDCESIYFVDPDGHKFEFHSGTLQDRLNYYREDKP-HMTFY-
47 PsiBlast_CBE 71.4835%-126 - C1 -2P7Q ? C:[1-129] MISGLSHITLIVKDLNKTTAFLQNIFNAEEIYSSGDKTFSLSKEKFFLIAGLWICIMEGDSLQER----TYNHIAFQIQSEEVDEYTERIKALGVEMKPERPRV---GRSIYFYDFDNHLFELHAGTLEQRLK--------------
57 PsiBlast_CBE 71.2935%-122 - C1 -2P7L FOSX_LISMO B:[1-131] MISGLSHITLIVKDLNKTTAFLQNIFNAEEIYSSGDKTFSLSKEKFFLIAGLWICIMEGDSLQER----TYNHIAFQIQSEEVDEYTERIKALGVEMKPE------EGRSIYFYDFDNHLFELHAGTLEERLKRY------------
19 PsiBlast_PDB 70.7635%-120 - C1 -2P7Q ? A:[1-130] MISGLSHITLIVKDLNKTTAFLQNIFNAEEIYSSGDKTFSLSKEKFFLIAGLWICIMEGDSLQER----TYNHIAFQIQSEEVDEYTERIKALGVEMKPERPRVQGEGRSIYFYDFDNHLFELHAGTLEQRLKR-------------
48 PsiBlast_CBE 70.5035%-115 - C1 -2P7Q ? B:[1-129] MISGLSHITLIVKDLNKTTAFLQNIFNAEEIYSSGDKTFSLSKEKFFLIAGLWICIMEGDSLQER----TYNHIAFQIQSEEVDEYTERIKALGVEMKPE-------GRSIYFYDFDNHLFELHAGTLEQRLK--------------
45 PsiBlast_CBE 69.9835%-115 - C1 -2P7Q ? E:[1-131] MISGLSHITLIVKDLNKTTAFLQNIFNAEEIYSSGDKTFSLSKEKFFLIAGLWICIMEGDSLQER----TYNHIAFQIQSEEVDEYTERIKALGVEMKPERPRVQGEGRSIYFYDFDNHLFELHAGTLEQRLKRY------------
44 PsiBlast_CBE 69.7835%-108 - C1 -2P7Q ? F:[1-131] MISGLSHITLIVKDLNKTTAFLQNIFNAEEIYSSGDKTFSLSKEKFFLIAGLWICIMEGDSLQER----TYNHIAFQIQSEEVDEYTERIKALGVEMKPERPRVQGEGRSIYFYDFDNHLFELHAGTLEQRLKRY------------
20 PsiBlast_PDB 69.7835%-116 - C1 -2P7K FOSX_LISMO A:[1-128] MISGLSHITLIVKDLNKTTAFLQNIFNAEEIYS-----LSKE--KFFLIAGLWICIMEGDSLQER----TYNHIAFQIQSEEVDEYTERIKALGVEMKPERPRVQGEGRSIYFYDFDNHLFELHAGTLEERL---------------
94 HHSearch 69.5737%-107 - C1 -1NKI FOSA_PSEAE A:[1-133] MLTGLNHLTLAVADLPASIAFYRDLL-GFRLEARWDQG------AYLELGSLWLCLSREPQY--GGPAADYTHYAFGIAAADFARFAAQLRAHGVREWKQN---RSEGDSFYFLDPDGHRLEAHVGDLRSRLAACRQAPYAGMRF--
59 PsiBlast_CBE 69.2135%-116 - C1 -2P7K FOSX_LISMO B:[1-128] MISGLSHITLIVKDLNKTTAFLQNIFNAEEIYS-----LSKE--KFFLIAGLWICIMEGDSLQER----TYNHIAFQIQSEEVDEYTERIKALGVEMKPERPRVQGEGRSIYFYDFDNHLFELHAGTLEERL---------------
40 PsiBlast_CBE 68.8835%-103 - C1 -1NKI FOSA_PSEAE B:[1-127] MLTGLNHLTLAVADLPASIAFYRDLL-GFRLEARWDQG------AYLELGSLWLCLSREPQY--GGPAADYTHYAFGIAAADFARFAAQLRAHGVREWK---QNRSEGDSFYFLDPDGHRLEAHVGDLRSRLAACRQAP--------
46 PsiBlast_CBE 67.9935%-106 - C1 -2P7Q ? D:[1-132] MISGLSHITLIVKDLNKTTAFLQNIFNAEEIYSSG---SKE---KFFLIAGLWICIMEGDSLQER----TYNHIAFQIQSEEVDEYTERIKALGVEMKPERPRVQGEGRSIYFYDFDNHLFELHAGTLEQRLKRYH-----------
17 PsiBlast_PDB 67.2235%-104 - C1 -1NKI FOSA_PSEAE A:[1-127] MLTGLNHLTLAVADLPASIAFYRDLL-GFRLEARWDQG------AYLELGSLWLCLSREPQY--GGPAADYTHYAFGIAAADFARFAAQLRAHGVREWK---QNRSEGDSFYFLDPDGHRLEAHVGDLRSRLAACRQAP--------