@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : jhp_0002: (2015-12-11 )
MQIIEGKLQLQGNEKIAILTSRFNHIITDRLKEGAMDCFKRHGGDEELLDLVLVPGAYELPLILDKLLESGKYDGVCVLGAIIRGGTPHFDYVSAEATKGIASAMLKYSMPVSFGVLTTDNIEQAIERAGSKAGNKGFEAMSTLIELLSLCQTLKD

Atome Classification :

(28 SA) .........10........20........30........40...-.....50........60........70........80........90........100.......110.......120.......130-........140.......150....
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MQIIEGKLQLQGNEKIAILTSRFNHIITDRLKEGAMDCFKRHGG-DEELLDLVLVPGAYELPLILDKLLESGKYDGVCVLGAIIRGGTPHFDYVSAEATKGIASAMLKYSMPVSFGVLTTDNIEQAIERAGS--KAGNKGFEAMSTLIELLSLCQTLKD
87 PsiBlast_CBE 90.5849%-119 - C6 -1ZIS RISB_BACSU J:[1-154] MNIIQGNLVGTG-LKIGIVVGRFNDFITSKLLSGAEDALLRHGV-DTNDIDVAWVPGAFEIPFAAKKMAETKKYDAIITLGTVIRGATTHYDYVCNEAAKGIAQAANTTGVPVIFGIVTTENIEQAIERAGT--KAGNKGVDCAVSAIEMANLNRSFE-
94 PsiBlast_CBE 90.4449%-120 - C6 -1ZIS RISB_BACSU C:[1-154] MNIIQGNLVGTG-LKIGIVVGRFNDFITSKLLSGAEDALLRHGV-DTNDIDVAWVPGAFEIPFAAKKMAETKKYDAIITLGTVIRGATTHYDYVCNEAAKGIAQAANTTGVPVIFGIVTTENIEQAIERAGT--KAGNKGVDCAVSAIEMANLNRSFE-
92 PsiBlast_CBE 90.2949%-119 - C6 -1ZIS RISB_BACSU E:[1-154] MNIIQGNLVGTG-LKIGIVVGRFNDFITSKLLSGAEDALLRHGV-DTNDIDVAWVPGAFEIPFAAKKMAETKKYDAIITLGTVIRGATTHYDYVCNEAAKGIAQAANTTGVPVIFGIVTTENIEQAIERAGT--KAGNKGVDCAVSAIEMANLNRSFE-
89 PsiBlast_CBE 90.1549%-120 - C6 -1ZIS RISB_BACSU H:[1-154] MNIIQGNLVGTG-LKIGIVVGRFNDFITSKLLSGAEDALLRHGV-DTNDIDVAWVPGAFEIPFAAKKMAETKKYDAIITLGTVIRGATTHYDYVCNEAAKGIAQAANTTGVPVIFGIVTTENIEQAIERAGT--KAGNKGVDCAVSAIEMANLNRSFE-
96 PsiBlast_CBE 90.0649%-120 - C6 -1RVV RISB_BACSU Z:[1-154] MNIIQGNLVGTG-LKIGIVVGRFNDFITSKLLSGAEDALLRHGV-DTNDIDVAWVPGAFEIPFAAKKMAETKKYDAIITLGTVIRGATTHYDYVCNEAAKGIAQAANTTGVPVIFGIVTTENIEQAIERAGT--KAGNKGVDCAVSAIEMANLNRSFE-
8 PsiBlast_PDB 89.6649%-120 - C6 -1RVV - RISB_BACSU A:[1-154] MNIIQGNLVGTG-LKIGIVVGRFNDFITSKLLSGAEDALLRHGV-DTNDIDVAWVPGAFEIPFAAKKMAETKKYDAIITLGTVIRGATTHYDYVCNEAAKGIAQAANTTGVPVIFGIVTTENIEQAIERAGT--KAGNKGVDCAVSAIEMANLNRSFE-
23 PsiBlast_CBE 89.6350%-117 - C6 -1NQX RISB_AQUAE C:[1-154] MQIYEGKLTAEGL-RFGIVASRFNHALVDRLVEGAIDCIVRHGG-REEDITLVRVPGSWEIPVAAGELARKEDIDAVIAIGVLIRGATPHFDYIASEVSKGLANLSLELRKPITFGVITADTLEQAIERAGT--KHGNKGWEAALSAIEMANLFKSLR-
197 Fugue 89.5049%-121 - C6 -1RVV - ? ?:[1-154] MNIIQGNLVGTGL-KIGIVVGRFNDFITSKLLSGAEDALLRHGV-DTNDIDVAWVPGAFEIPFAAKKMAETKKYDAIITLGTVIRGATTHYDYVCNEAAKGIAQAANTTGVPVIFGIVTTENIEQAIERAGT--KAGNKGVDCAVSAIEMANLNRSFE-
9 PsiBlast_PDB 89.5049%-118 - C6 -1ZIS RISB_BACSU A:[1-154] MNIIQGNLVGTG-LKIGIVVGRFNDFITSKLLSGAEDALLRHGV-DTNDIDVAWVPGAFEIPFAAKKMAETKKYDAIITLGTVIRGATTHYDYVCNEAAKGIAQAANTTGVPVIFGIVTTENIEQAIERAGT--KAGNKGVDCAVSAIEMANLNRSFE-
86 PsiBlast_CBE 89.4948%-118 - C6 -3MK3 RISB_SALTY Z:[1-154] MNIIKANVAAP-DARVAITIARFNQFINDSLLDGAVDALTRIGQVKDDNITVVWVPGAYELPLATEALAKSGKYDAVVALGTVIRGGTAHFEYVAGGASNGLASVAQDSGVPVAFGVLTTESIEQAIERAGT--KAGNKGAEAALTALEMINVLKAI--
61 PsiBlast_CBE 89.2248%-117 - C6 -3NQ4 RISB_SALTY Z:[1-154] MNIIKANVAAP-DARVAITIARFNQFINDSLLDGAVDALTRIGQVKDDNITVVWVPGAYELPLATEALAKSGKYDAVVALGTVIRGGTAHFEYVAGGASNGLASVAQDSGVPVAFGVLTTESIEQAIERAGT--KAGNKGAEAALTALEMINVLKAI--