@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : jhp_0004: (2015-12-11 )
MEAFLGALEFQENEYEEFKELYESLKTKQKPHTLFISCVDSRVVPNLITGTQPGELYVIRNMGNVIPPKTSYKESLSTIASVEYAIAHVGVQNLIICGHSDCGACGSIHLIHDETTKAKTPYIANWIQFLEPIKEELKNHPQFSNHFAKRSWLTERLNARLQLNNLLSYDFIQERVINNELKIFGWHYIIETGRIYNYNFESHFFEPIEETIKQRISHENF

Atome Classification :

(20 SA) ----------------------------.........10........20........30........40........50........60........70........80........90........100...-....110.......120.......130.----......140......--.150.......160......-.170.---....-..-180.------.......190.......200.......210.......220-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) ----------------------------MEAFLGALEFQENEYEEFKELYESLKTKQKPHTLFISCVDSRVVPNLITGTQPGELYVIRNMGNVIPPKTSYKESLSTIASVEYAIAHVGVQNLIICGHSDCGAC-GSIHLIHDETTKAKTPYIANWIQFLEPI----KEELKNHPQFSNHFA--KRSWLTERLNARLQLNNLLS-YDFIQ---ERVI-NN-E-LK------IFGWHYIIETGRIYNYNFESHFFEPIEETIKQRISHENF--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
53 Fugue 93.7729%-104 - C6 -1EKJ CAHC_PEA A:[12-221] -------------------------EASERIKTGFLHFKKEKYDKNPALYGELAKGQSPPFMVFACSDSRVCPSHVLDFQPGEAFVVRNVANLVPPYDQ-AKYAGTGAAIEYAVLHLKVSNIVVIGHSACGGI-KGLLSFPFDGTY-STDFIEEWVKIGLPA----KAKVKAQHG-DAPFA--ELCTHCEKEAVNASLGNLLT-YPFVR---EGLV-NK-T-LA------LKGGYYDFVKGSFELWGLEFGLSSTFSV-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
54 Fugue 93.5129%-104 - C6 -1EKJ CAHC_PEA A:[12-221] -------------------------EASERIKTGFLHFKKEKYDKNPALYGELAKGQSPPFMVFACSDSRVCPSHVLDFQPGEAFVVRNVANLVPPYDQ-AKYAGTGAAIEYAVLHLKVSNIVVIGHSACGGI-KGLLS-FPFDGTYSTDFIEEWVKIGLPA----KAKVKAQHGDA-PFA--ELCTHCEKEAVNASLGNLLT-YPFVR---EGLV-NK-T-LA------LKGGYYDFVKGSFELWGLEFGLS---------------STFSV----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
35 HHSearch 92.9531%-105 - C6 -1EKJ CAHC_PEA A:[15-214] ----------------------------ERIKTGFLHFKKEKYDKNPALYGELAKGQSPPFMVFACSDSRVCPSHVLDFQPGEAFVVRNVANLVPPYDQA-KYAGTGAAIEYAVLHLKVSNIVVIGHSACGGI-KGLLSFPFDGT-YSTDFIEEWVKIGLPA----KAKVKAQH-GDAPFA--ELCTHCEKEAVNASLGNLLT-YPFVR---EGLV-NK-T-LA------LKGGYYDFVKGSFELWGLEFGLSSTFSV-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
1 PsiBlast_PDB 92.4132%-102 - C6 -1EKJ CAHC_PEA A:[20-212] ---------------------------------GFLHFKKEKYDKNPALYGELAKGQSPPFMVFACSDSRVCPSHVLDFQPGEAFVVRNVANLVPPYDQAKYA-GTGAAIEYAVLHLKVSNIVVIGHSACGGIKGLLSFPFDGTY--STDFIEEWVKIGLPA----KAKVKAQ-HGDAPFA--ELCTHCEKEAVNASLGNLLT-YPFVR---EGLV-NK-T-LA------LKGGYYDFVKGSFELWGLEFGLSSTFSV-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
25 PsiBlast_CBE 92.4032%-105 - C6 -1EKJ CAHC_PEA D:[20-212] ---------------------------------GFLHFKKEKYDKNPALYGELAKGQSPPFMVFACSDSRVCPSHVLDFQPGEAFVVRNVANLVPPYDQAKYA-GTGAAIEYAVLHLKVSNIVVIGHSACGGIKGLLSFPFDGTY--STDFIEEWVKIGLPA----KAKVKAQ-HGDAPFA--ELCTHCEKEAVNASLGNLLT-YPFVR---EGLV-NK-T-LA------LKGGYYDFVKGSFELWGLEFGLSSTFSV-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
26 PsiBlast_CBE 92.0732%-106 - C6 -1EKJ CAHC_PEA C:[20-212] ---------------------------------GFLHFKKEKYDKNPALYGELAKGQSPPFMVFACSDSRVCPSHVLDFQPGEAFVVRNVANLVPPYDQAKYA-GTGAAIEYAVLHLKVSNIVVIGHSACGGIKGLLSFPFDGTY--STDFIEEWVKIGLPA----KAKVKAQ-HGDAPFA--ELCTHCEKEAVNASLGNLLT-YPFVR---EGLV-NK-T-LA------LKGGYYDFVKGSFELWGLEFGLSSTFSV-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
27 PsiBlast_CBE 91.8632%-100 - C6 -1EKJ CAHC_PEA B:[20-212] ---------------------------------GFLHFKKEKYDKNPALYGELAKGQSPPFMVFACSDSRVCPSHVLDFQPGEAFVVRNVANLVPPYDQAKYA-GTGAAIEYAVLHLKVSNIVVIGHSACGGIKGLLSFPFDGTY--STDFIEEWVKIGLPA----KAKVKAQ-HGDAPFA--ELCTHCEKEAVNASLGNLLT-YPFVR---EGLV-NK-T-LA------LKGGYYDFVKGSFELWGLEFGLSSTFSV-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
24 PsiBlast_CBE 91.7432%-104 - C6 -1EKJ CAHC_PEA E:[20-212] ---------------------------------GFLHFKKEKYDKNPALYGELAKGQSPPFMVFACSDSRVCPSHVLDFQPGEAFVVRNVANLVPPYDQAKYA-GTGAAIEYAVLHLKVSNIVVIGHSACGGIKGLLSFPFDGTY--STDFIEEWVKIGLPA----KAKVKAQ-HGDAPFA--ELCTHCEKEAVNASLGNLLT-YPFVR---EGLV-NK-T-LA------LKGGYYDFVKGSFELWGLEFGLSSTFSV-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
23 PsiBlast_CBE 91.4232%-101 - C6 -1EKJ CAHC_PEA F:[20-212] ---------------------------------GFLHFKKEKYDKNPALYGELAKGQSPPFMVFACSDSRVCPSHVLDFQPGEAFVVRNVANLVPPYDQAKYA-GTGAAIEYAVLHLKVSNIVVIGHSACGGIKGLLSFPFDGTY--STDFIEEWVKIGLPA----KAKVKAQ-HGDAPFA--ELCTHCEKEAVNASLGNLLT-YPFVR---EGLV-NK-T-LA------LKGGYYDFVKGSFELWGLEFGLSSTFSV-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
21 PsiBlast_CBE 91.3632%-107 - C6 -1EKJ CAHC_PEA H:[20-212] ---------------------------------GFLHFKKEKYDKNPALYGELAKGQSPPFMVFACSDSRVCPSHVLDFQPGEAFVVRNVANLVPPYDQAKYA-GTGAAIEYAVLHLKVSNIVVIGHSACGGIKGLLSFPFDGTY--STDFIEEWVKIGLPA----KAKVKAQ-HGDAPFA--ELCTHCEKEAVNASLGNLLT-YPFVR---EGLV-NK-T-LA------LKGGYYDFVKGSFELWGLEFGLSSTFSV-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
13 PsiBlast_PDB 87.8428%-116 - C6 -1T75 CAN_ECOLI A:[20-210] -------------------------------------------EEDPGFFEKLAQAQKPRFLWIGCSDSRVPAERLTGLEPGELFVHRNVANLV-----IHTDLNCLSVVQYAVDVLEVEHIIICGHYGCGG-------VQAAVENPELGLINNWLLHIRDIWFKHSSLLGEMPQ-----E--RRLDTLCELNVMEQVYNLGH-STIMQ---SAWK-RG-QKVT------IHGWAYGIHDGLLRDLDVTATNRETLEQRYRHGISNLKL--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
12 PsiBlast_PDB 87.1428%-116 - C6 -1I6P CAN_ECOLI A:[20-210] -------------------------------------------EEDPGFFEKLAQAQKPRFLWIGCSDSRVPAERLTGLEPGELFVHRNVANLV-----IHTDLNCLSVVQYAVDVLEVEHIIICGHYGCGG-------VQAAVENPELGLINNWLLHIRDIWFKHSSLLGEMPQ-----E--RRLDTLCELNVMEQVYNLGH-STIMQ---SAWK-RG-QKVT------IHGWAYGIHDGLLRDLDVTATNRETLEQRYRHGISNLKL--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
14 PsiBlast_PDB 87.0028%-117 - C6 -2ESF CAN_ECOLI A:[20-210] -------------------------------------------EEDPGFFEKLAQAQKPRFLWIGCSDSRVPAERLTGLEPGELFVHRNVANLV-----IHTDLNCLSVVQYAVDVLEVEHIIICGHYGCGG-------VQAAVENPELGLINNWLLHIRDIWFKHSSLLGEMPQ-----E--RRLDTLCELNVMEQVYNLGH-STIMQ---SAWK-RG-QKVT------IHGWAYGIHDGLLRDLDVTATNRETLEQRYRHGISNLKL--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
33 HHSearch 86.8128%-105 * C6 *3QY1 ? A:[8-216] ----------------------------DTLISNNALWSKMLVEEDPGFFEKLAQAQKPRFLWIGCSDSRVPAERLTGLEPGELFVHRNVANLVIHT-----DLNCLSVVQYAVDVLEVEHIIICGHSGCGGI-KAAVENP------ELGLINNWLLHIRDI----WLKHSSLL-GKMPEE--QRLDALYELNVMEQVYNLGH-STIMQ---SAWK-RG-QNVT------IHGWAYSINDGLLRDLDVTATNRETLENGYHKGISALSL--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
15 PsiBlast_PDB 86.3728%-112 - C6 -4ZNZ ? A:[20-210] -------------------------------------------EEDPGFFEKLAQAQKPRFLWIGCSDSRVPAERLTGLEPGELFVHRNVANLV-----IHTDLNCLSVVQYAVDVLEVEHIIICGHYGCGG-------VQAAVENPELGLINNWLLHIRDIWFKHSSLLGEMPQ-----E--RRLDTLCELNVMEQVYNLGH-STIMQ---SAWK-RG-QKVT------IHGWAYGIHDGLLRDLDVTATNRETLEQRYRHGISNLKL--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
16 PsiBlast_PDB 85.8628%-116 - C6 -1I6O CAN_ECOLI A:[20-210] -------------------------------------------EEDPGFFEKLAQAQKPRFLWIGCSDSRVPAERLTGLEPGELFVHRNVANLV-----IHTDLNCLSVVQYAVDVLEVEHIIICGHYGCGG-------VQAAVENPELGLINNWLLHIRDIWFKHSSLLGEMPQ-----E--RRLDTLCELNVMEQVYNLGH-STIMQ---SAWK-RG-QKVT------IHGWAYGIHDGLLRDLDVTATNRETLEQRYRHGISNLKL--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
36 HHSearch 85.0625%-120 - C6 -3E3I CAN_HAEIN A:[5-209] ----------------------------KQLFANNYSWAQRMKEE------------TPHYLWIACSDSRVPAEKLTNLEPGELFVHRNVANQVIHT-----DFNCLSVVQYAVDVLKIEHIIICGHTNCGGI-HAAMADK------DLGLINNWLLHIRDI----WFKHGHLL-GKLSPE--KRADMLTKINVAEQVYNLGR-TSIVK---SAWE-RGQK-LS------LHGWVYDVNDGFLVDQGVMATSRETLEISYRNAIARLSI--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
19 PsiBlast_PDB 84.1427%-108 - C6 -3MF3 CAN_HAEIN A:[20-210] -------------------------------------------EENSTYFKELADHQTPHYLWIGCSDSRVPAEKLTNLEPGELFVHRNVANQV-----IHTDFNCLSVVQYAVDVLKIEHIIICGHTNCGG-------IHAAMADKDLGLINNW---LLHI----RDIWFKHGHLLGKLSPEKRADMLTKINVAEQVYNLGR-TSIVKSAWER---GQ-K-LS------LHGWVYDVNDGFLVDQGVMATSRETLEISYRNAIARLSI--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
55 Fugue 82.9720%-102 - C6 -1DDZ ? A:[9-489] VMSDLEKKFIELEAKLVAQPAGQAMPGKSNIFANNEAWRQEMLKQDPEFFNRLANGQSPEYLWIGCADSRVPANQLLDLPAGEVFVHRNIANQCIH-----SDISFLSVLQYAVQYLKVKHILVCGHYGCGGA-KAALG------DSRLGLIDNWLRHIRDV----RRMNAKYLDKCKDGD--EELNRLIELNVLEQVHNVCA-TSIVQ---DAWDAGQ-E-LT------VQGVVYGVGDGKLRDLGVVVNSSDDISKFYRTKSDSGALKAGNPNAPLVQVTKGGESELDSTMEKLTAELVQQTPGKLKEGANRVFVNNENWRQKMLKQDPQFFSNLAHTQTPEILWIGCADSRVPANQIINLPAGEVFVHRNIANQCIHSDMSFLSVLQYAVQYLKVKRVVVCGHYACGGCAAALGDSRLGLIDNWLRHIRDVRRHNQAELSRITDPKDSLNRLIEINVLEQMHNVCATSIVQDAWDAGQELEVQGVVYGVGDGKLRDMGVVAKANDDIG
9 PsiBlast_PDB 82.9229%-104 - C6 -3QY1 ? A:[23-213] -------------------------------------------EEDPGFFEKLAQAQKPRFLWIGCSDSRVPAERLTGLEPGELFVHRNVANLV-----IHTDLNCLSVVQYAVDVLEVEHIIICGHSGCGG-------IKAAVENPELGLINNW---LLHI----RDIWLKHSSLLGKMP--EE----QRLDALYELNVMEQVYNLGH---STIM-QS-A-WKRGQNVTIHGWAYSINDGLLRDLDVTATNRETLENGYHKGISALSL--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------