@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : jhp_0028: (2015-12-11 )
MKMHQIPTPTMSQVIMLNDSITTAEFMVSALRDFFDKPLEEAQKLMLSIHRDGDGVCGVYPYEIAIYKAVCVRDKARARFPLRLMVQEVK

Atome Classification :

(20 SA) .........10........20........30........40........50........60........70.....-..-.-80........90
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MKMHQIPTPTMSQVIMLNDSITTAEFMVSALRDFFDKPLEEAQKLMLSIHRDGDGVCGVYPYEIAIYKAVCVRDKA-RA-R-FPLRLMVQEVK
2 PsiBlast_PDB 96.3843%-137 - C2 -3GQ0 - CLPS_CAUCR A:[38-118] --------PSLYRVLILNDDYTPMEFVVYVLERFFNKSREDATRIMLHVHQNGVGVCGVYTYEVAETKVAQVIDSARRH-Q-HPLQCTMEKD-
20 PsiBlast_CBE 96.1744%-136 - C2 -3G3P CLPS_CAUCR B:[4-84] --------PSLYRVLILNDDYTPAEFVVYVLERFFNKSREDATRIMLHVHQNGVGVCGVYTYEVAETKVAQVIDSARRH-Q-HPLQCTMEKD-
21 PsiBlast_CBE 95.7344%-143 - C2 -3G1B CLPS_CAUCR B:[5-84] ---------SLYRVLILNDDYTPAEFVVYVLERFFNKSREDATRIMLHVHQNGVGVCGVYTYEVAETKVAQVIDSARRH-Q-HPLQCTMEKD-
24 PsiBlast_CBE 95.4443%-141 - C2 -3DNJ CLPS_CAUCR B:[5-84] ---------SLYRVLILNDDYTPMEFVVYVLERFFNKSREDATRIMLHVHQNGVGVCGVYTYEVAETKVAQVIDSARRH-Q-HPLQCTMEKD-
22 PsiBlast_CBE 95.1943%-141 - C2 -3GW1 CLPS_CAUCR B:[4-84] --------PSLYRVLILNDDYTPMEFVVYVLERFFNKSREDATRIMLHVHQNGVGVCGVYTYEVAETKVAQVIDSARRH-Q-HPLQCTMEKD-
1 PsiBlast_PDB 95.1943%-135 - C2 -3G19 CLPS_CAUCR A:[4-84] --------PSLYRVLILNDDYTPMEFVVYVLERFFNKSREDATRIMLHVHQNGVGVCGVYTYEVAETKVAQVIDSARRH-Q-HPLQCTMEKD-
23 PsiBlast_CBE 94.5943%-142 - C2 -3GQ1 CLPS_CAUCR B:[4-84] --------PSLYRVLILNDDYTPMEFVVYVLERFFNKSREDATRIMLHVHQNGVGVCGVYTYEVAETKVAQVIDSARRH-Q-HPLQCTMEKD-
3 PsiBlast_PDB 94.5443%-139 - C2 -3GW1 CLPS_CAUCR A:[4-84] --------PSLYRVLILNDDYTPMEFVVYVLERFFNKSREDATRIMLHVHQNGVGVCGVYTYEVAETKVAQVIDSARRH-Q-HPLQCTMEKD-
39 HHSearch 92.1534%-128 - C2 -2W9R CLPS_ECOLI A:[18-107] -VRDALKPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKAICGVFTAEVAETKVAMVNKYA-RENE-HPLLCTLEKAG
37 HHSearch 88.2836%-137 - C2 -3O1F - CLPS_ECOLI A:[26-106] ---------SMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKAICGVFTAEVAETKVA-VNKYA-RENE-HPLLCTLEKA-
51 Fugue 86.6034%-116 * C2 *1MG9 - CLPS_ECOLI A:[23-106] ------KPPSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVAYQGKAICGVFTAEVAETKVAMVNKYA-RE-NEHPLLCTLEKA-
26 PsiBlast_CBE 86.1140%-134 - C2 -1R6Q CLPS_ECOLI D:[25-93] --------PSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKAICGVFTAEVAETKVAMVNKYA-RE-N-EHPLLCTLEKA
27 PsiBlast_CBE 85.7240%-135 - C2 -1R6O CLPS_ECOLI D:[25-93] --------PSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKAICGVFTAEVAETKVAMVNKYA-RE-N-EHPLLCTLEKA
9 PsiBlast_PDB 83.7440%-135 - C2 -1R6O CLPS_ECOLI C:[25-93] --------PSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKAICGVFTAEVAETKVAMVNKYA-RE-N-EHPLLCTLEKA
28 PsiBlast_CBE 83.0240%-138 - C2 -1MBX CLPS_ECOLI D:[25-93] --------PSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKAICGVFTAEVAETKVAMVNKYA-RE-N-EHPLLCTLEKA
10 PsiBlast_PDB 82.7540%-134 - C2 -1R6Q CLPS_ECOLI C:[25-93] --------PSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKAICGVFTAEVAETKVAMVNKYA-RE-N-EHPLLCTLEKA
29 PsiBlast_CBE 82.1440%-136 - C2 -1MBU CLPS_ECOLI D:[25-93] --------PSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKAICGVFTAEVAETKVAMVNKYA-RE-N-EHPLLCTLEKA
11 PsiBlast_PDB 81.7340%-133 - C2 -2W9R CLPS_ECOLI A:[25-93] --------PSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKAICGVFTAEVAETKVAMVNKYA-RE-N-EHPLLCTLEKA
8 PsiBlast_PDB 81.3340%-133 - C2 -1MBX CLPS_ECOLI C:[25-93] --------PSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKAICGVFTAEVAETKVAMVNKYA-RE-N-EHPLLCTLEKA
36 PsiBlast_CBE 81.2940%-133 - C2 -3O2B CLPS_ECOLI C:[24-92] --------PSMYKVILVNDDYTPMEFVIDVLQKFFSYDVERATQLMLAVHYQGKAICGVFTAEVAETKVAMVNKYA-RE-N-EHPLLCTLEKA