@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : jhp_0031: (2015-12-11 )
MDFSQLGGLSGLLDGVKKEFSQLEEKNKDTIHTSKSGGGMVSVSFNGLGELVDLQIDDSLLEDKEAMQIYLMSALNDGYKAVEENRKNLAFNMLGNFAKL

Atome Classification :

(20 SA) ------.....---....10..-......20-..-......30.-------.......40.....-...50........60-..---....-..---.-----70........80........-90........100----
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) ------MDFSQ---LGGLSGLL-DGVKKEFS-QL-EEKNKDTIH-------TSKSGGGMVSVSFN-GLGELVDLQIDDSL--LE---DKEA-MQ---I-----YLMSALNDGYKAVEENRKNL-AFNMLGNFAKL------
38 HHSearch 92.7399% -85 - C3 -3F42 Y035_HELPY A:[3-94] ------MDFSQ---LG---GLL-DGMKKEFS-QL-EEKNKDTIH-------TSKSGGGMVSVSFN-GLGELVDLQIDDSL--LE---DKEA-MQ---I-----YLMSALNDGYKAVEENRKNL-AFNMLG-----------
1 PsiBlast_PDB 90.1091% -82 - C3 -3F42 Y035_HELPY A:[4-94] -------DFSQ---LGGL---L-DGMKKEFS-QL-EEKNKDTIH-------TSKSGGGMVSVSFN-GLGELVDLQIDDSL--LE---DKEA-MQ---I-----YLMSALNDGYKAVEENRKNL-AFNMLG-----------
40 HHSearch 63.4518% -58 * C3 *1YBX Y2143_CLOTH A:[43-133] --------------INNLVKQA-QKMQRDME-RV-QEELKEKTV-------EASAGGGAVTVVAT-GRKDIKEITIKPEV--VDPD-DVEM-LQ---D-----LILAAVNEALRKADEMVTAE-ISKIT------------
2 PsiBlast_PDB 59.0734% -75 - C3 -1PUG - YBAB_ECOLI A:[11-89] ---------------------M-----KQAQ-QM-QEKMQKMQEEIAQLEVTGESGAGLVKVTIN-GAHNCRRVEIDPSL--LED--DKEM-LE---D-----LVAAAFNDAARRIEETQKEK-MASVSSGMQLP------
3 PsiBlast_PDB 47.6737% -38 - C3 -1J8B - Y442_HAEIN A:[34-89] ---------------------------------------------------TGESGAGLVKITIN-GAHNCRRIDIDPSL--MED--DKEM-LE---D-----LIAAAFNDAVRRAEELQKEK-MASVTAG----------
39 HHSearch 44.2624% 8 - C3 -1J8B - Y442_HAEIN A:[7-98] --------LGG---LM---KQA-QQ-QEKMQ-KM-QEEIAQLEV-------TGESGAGLVKITIN-GAHNCRRIDIDPSL--MED--DKEM-LE---D-----LIAAAFNDAVRRAEELQKEK-MASVTAG----------
59 Fugue 43.4120% -27 * C2 *4DY5 ? A:[1-111] TGKNVNVEFDKGQNSARYSGVI-KGYDYDTY-NF-QARKGQKVH-------VSISNEGADTYLFGPGISDSVDLSRYSSE--LD---GNGQ-YT---LPASGKYELKVLQTRNEARKNKAKKY-SVNIQIK----------
58 Fugue 43.2428% -6 - C3 -1J8B - Y442_HAEIN A:[7-98] ------------------LGGLMKQAQQQEKMQKMQEEIAQLEV-------TGESGAGLVKITIN-GAHNCRRIDIDPSLM-E----DDKEMLE---D-----LIAAAFNDAVRRAEELQKEKMASVTAG-----------
60 Fugue 39.6721% 13 - C3 -1PU1 - Y677_METTH A:[1-91] ------MSLRK---LT-----E-GDLDEISS-FL-HNTISDFIL-------KRVSAKEIVDIDIT-VLVEYTDE--------LK---VDIS-AE---L-----YL-DELSDADPGIVDEAVDA-AYRSLESFLDGFRE---
66 Fugue 39.3411% -24 - C2 -1P68 - ? A:[1-102] ----------M---YGKLNDLL-EDLQEVLK-NL-HKNWHGGKD-------NLHDVDNHLQNVIE-DIHDFMQGGGSGGK--LQ---EMMK-EF---Q-----QVLDELNNHLQGGKHTVHHI-EQNIKEIFHHLEELVHR
4 PsiBlast_PDB 39.0338% -31 - C3 -2Y6R - ? A:[269-302] --------------------VV-DFLLKEFS-DW-DERYKELIH-------TTLSFVGLATRIFP-LEKPWKSKRPLPIT--MI---GDAA-HL---M-----PPFAGQGVNSGLVDALILSD-NLADGKFNSIE------
32 PsiBlast_CBE 38.4738% -28 - C3 -2Y6Q ? D:[269-302] --------------------VV-DFLLKEFS-DW-DERYKELIH-------TTLSFVGLATRIFP-LEKPWKSKRPLPIT--MI---GDAA-HL---M-----PPFAGQGVNSGLVDALILSD-NLADGKFNSIE------
42 HHSearch 38.3218% -29 - C3 -1J8B - Y442_HAEIN A:[7-92] ---------------------L-GGLMKQAQ-Q--QEKMQKMQE-------EIA----QLEVTGE-SGAGLVKITINGAHNCRRIDIDPSL-MEDDKE-----MLEDLIAAAFNDAVRRAEEL-QKEKMASVTAG------
33 PsiBlast_CBE 38.1738% -29 - C3 -2Y6Q ? C:[269-302] --------------------VV-DFLLKEFS-DW-DERYKELIH-------TTLSFVGLATRIFP-LEKPWKSKRPLPIT--MI---GDAA-HL---M-----PPFAGQGVNSGLVDALILSD-NLADGKFNSIE------
28 PsiBlast_CBE 38.0038% -27 - C3 -4A99 ? C:[269-302] --------------------VV-DFLLKEFS-DW-DERYKELIH-------TTLSFVGLATRIFP-LEKPWKSKRPLPIT--MI---GDAA-HL---M-----PPFAGQGVNSGLVDALILSD-NLADGKFNSIE------
30 PsiBlast_CBE 37.9638% -25 - C3 -4A6N ? D:[269-302] --------------------VV-DFLLKEFS-DW-DERYKELIH-------TTLSFVGLATRIFP-LEKPWKSKRPLPIT--MI---GDAA-HL---M-----PPFAGQGVNSGLVDALILSD-NLADGKFNSIE------
34 PsiBlast_CBE 37.9538% -28 - C3 -2Y6Q ? B:[269-302] --------------------VV-DFLLKEFS-DW-DERYKELIH-------TTLSFVGLATRIFP-LEKPWKSKRPLPIT--MI---GDAA-HL---M-----PPFAGQGVNSGLVDALILSD-NLADGKFNSIE------
7 PsiBlast_PDB 37.8938% -27 - C3 -4A6N - ? B:[269-302] --------------------VV-DFLLKEFS-DW-DERYKELIH-------TTLSFVGLATRIFP-LEKPWKSKRPLPIT--MI---GDAA-HL---M-----PPFAGQGVNSGLVDALILSD-NLADGKFNSIE------
53 HHSearch 37.5217% -83 - C3 -2OD0 ? A:[80-103] --------------------------------------------------------------------------AISSEL--WE---SSDR-LI---E-----VAKKSLENAKL---------------------------
5 PsiBlast_PDB 37.4538% -24 - C3 -2XDO ? A:[269-302] --------------------VV-DFLLKEFS-DW-DERYKELIH-------TTLSFVGLATRIFP-LEKPWKSKRPLPIT--MI---GDAA-HL---M-----PPFAGQGVNSGLVDALILSD-NLADGKFNSIE------