@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : jhp_0082: (2015-12-12 )
MQKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIPESAIFIETSGSLNALAKKIANEQHIALKEGVIASGDQFVHSKERKEFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDNADEKAGMSFDEFLEKSAHTSAKFLKSMVDEL

Atome Classification :

(67 SA) .........10........20........30........40........50........60........70........80........90........100.......110...-....120.......130.-....-..140.......150...-----...-----.160.....-..-170.......180.......190.......200.......210.......220---........230
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MQKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIP-ESAIFIETSGSLNALAKK-IANE-QHIALKEGVIASGDQFVH-----SKE-----RKEFLVSEF-KA-SAVEMEGASVAFVCQKFGVPCCVLRSISDNADEKAGMSFDEFLEKSAHTSAK----FLKSMVDEL
22 PsiBlast_CBE 97.26100%-126 - C1 -3NM4 MQMTN_HELPJ B:[2-230] -QKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIP-ESAIFIETSGSLNALAKK-IANE-QHIALKEGVIASGDQFVH-----SKE-----RKEFLVSEF-KA-SAVEMEGASVAFVCQKFGVPCCVLRSISDN-------SFDEFLEKSAHTSAK----FLKSMVDEL
8 PsiBlast_PDB 96.4195%-126 - C1 -4BMX MQMTN_HELPY A:[22-251] VQKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVAIQLVQHDVDLSAFDHPLGFIP-ESAIFIETSESLNALAKE-VANE-QHIVLKEGVIASGDQFVH-----SKE-----RKEFLVSEF-KA-SAVEMEGASVAFVCQKFGVPCCVLRSISDN-------SFDAFLEKSAQTSAK----FLKSMVDEL
2 PsiBlast_PDB 96.27100%-117 - C1 -3NM5 MQMTN_HELPJ A:[2-230] -QKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIP-ESAIFIETSGSLNALAKK-IANE-QHIALKEGVIASGDQFVH-----SKE-----RKEFLVSEF-KA-SAVEMEGASVAFVCQKFGVPCCVLRSISDNADEKAGMSFDEFLEKSAHTSAK----FLKSMVDEL
21 PsiBlast_CBE 96.17100%-117 - C1 -3NM5 MQMTN_HELPJ B:[2-230] -QKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIP-ESAIFIETSGSLNALAKK-IANE-QHIALKEGVIASGDQFVH-----SKE-----RKEFLVSEF-KA-SAVEMEGASVAFVCQKFGVPCCVLRSISDNADEKAGMSFDEFLEKSAHTSAK----FLKSMVDEL
1 PsiBlast_PDB 96.09100%-117 - C1 -3NM4 MQMTN_HELPJ A:[2-230] -QKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIP-ESAIFIETSGSLNALAKK-IANE-QHIALKEGVIASGDQFVH-----SKE-----RKEFLVSEF-KA-SAVEMEGASVAFVCQKFGVPCCVLRSISDNADEKAGMSFDEFLEKSAHTSAK----FLKSMVDEL
6 PsiBlast_PDB 95.6899%-120 - C1 -4P54 MQMTN_HELPJ A:[3-231] -QKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIP-ESAIFIETSGSLNALAKK-IANE-QHIALKEGVIASGDQFVH-----SKE-----RKEFLVSEF-KA-SAVEMEGASVAFVCQKFGVPCCVLRSISNNADEKAGMSFDEFLEKSAHTSAK----FLKSMVDEL
3 PsiBlast_PDB 95.66100%-116 - C1 -3NM6 MQMTN_HELPJ B:[2-230] -QKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIP-ESAIFIETSGSLNALAKK-IANE-QHIALKEGVIASGDQFVH-----SKE-----RKEFLVSEF-KA-SAVEMEGASVAFVCQKFGVPCCVLRSISDNADEKAGMSFDEFLEKSAHTSAK----FLKSMVDEL
4 PsiBlast_PDB 95.54100%-117 - C1 -4FFS MQMTN_HELPJ A:[10-239] MQKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIP-ESAIFIETSGSLNALAKK-IANE-QHIALKEGVIASGDQFVH-----SKE-----RKEFLVSEF-KA-SAVEMEGASVAFVCQKFGVPCCVLRSISDNADEKAGMSFDEFLEKSAHTSAK----FLKSMVDEL
7 PsiBlast_PDB 95.0499%-119 - C1 -4OY3 MQMTN_HELPJ A:[3-231] -QKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIP-ESAIFIETSGSLNALAKK-IANE-QHIALKEGVIASGDQFVH-----SKE-----RKEFLVSEF-KA-SAVEMEGASVAFVCQKFGVPCCVLRSISNNADEKAGMSFDEFLEKSAHTSAK----FLKSMVDEL
9 PsiBlast_PDB 94.8095%-125 - C1 -4BN0 - MQMTN_HELPY A:[22-251] VQKIGILGAMREQITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVAIQLVQHDVDLSAFDHPLGFIP-ESAIFIETSESLNALAKE-VANE-QHIVLKEGVIASGDQFVH-----SKE-----RKEFLVSEF-KA-SAVEMEGASVAFVCQKFGVPCCVLRSISDN-------SFDAFLEKSAQTSAK----FLKSMVDEL
5 PsiBlast_PDB 94.56100%-115 - C1 -4OJT MQMTN_HELPJ A:[3-231] -QKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIP-ESAIFIETSGSLNALAKK-IANE-QHIALKEGVIASGDQFVH-----SKE-----RKEFLVSEF-KA-SAVEMEGASVAFVCQKFGVPCCVLRSISDNADEKAGMSFDEFLEKSAHTSAK----FLKSMVDEL
24 PsiBlast_CBE 94.0395%-117 - C1 -4BMZ MQMTN_HELPY B:[22-251] VQKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVAIQLVQHDVDLSAFDHPLGFIP-ESAIFIETSESLNALAKE-VANE-QHIVLKEGVIASGDQFVH-----SKE-----RKEFLVSEF-KA-SAVEMEGASVAFVCQKFGVPCCVLRSISNNADEEANMSFDAFLEKSAQTSAK----FLKSMVDEL
10 PsiBlast_PDB 93.6195%-117 - C1 -4BMZ MQMTN_HELPY A:[22-251] VQKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVAIQLVQHDVDLSAFDHPLGFIP-ESAIFIETSESLNALAKE-VANE-QHIVLKEGVIASGDQFVH-----SKE-----RKEFLVSEF-KA-SAVEMEGASVAFVCQKFGVPCCVLRSISNNADEEANMSFDAFLEKSAQTSAK----FLKSMVDEL
23 PsiBlast_CBE 93.2895%-115 - C1 -4BMX MQMTN_HELPY B:[22-251] VQKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVAIQLVQHDVDLSAFDHPLGFIP-ESAIFIETSESLNALAKE-VANE-QHIVLKEGVIASGDQFVH-----SKE-----RKEFLVSEF-KA-SAVEMEGASVAFVCQKFGVPCCVLRSISDNADEEANMSFDAFLEKSAQTSAK----FLKSMVDEL
11 PsiBlast_PDB 93.1895%-121 - C1 -4BMY MQMTN_HELPY A:[22-251] VQKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVAIQLVQHDVDLSAFDHPLGFIP-ESAIFIETSESLNALAKE-VANE-QHIVLKEGVIASGDQFVH-----SKE-----RKEFLVSEF-KA-SAVEMEGASVAFVCQKFGVPCCVLRSISANADEE-----DAFLEKSAQTSAK----FLKSMVDEL
13 PsiBlast_PDB 77.3549%-107 - C1 -4JOS ? A:[24-250] -KKIAILGAMEIEIQPILQKLE-KYETVEYANNKYYVANYNGIELVVAYSKIGKVFSSLTATIMIEHFGVDALLFTGVAGGL-QDLQVGDMIAATATVQHDVDITAFGYPYGKIP-ISEVEIATSARILEQAKV-IAKE-LNLNLHTGVIATGDQFVH-----SAE-----RKDFVVKEF-DA-KAIEMEGASVNLICNEMNIPSFILRSISDTADGDAPDNFDEFAKMAANRSAD----FVMKLVDRI
12 PsiBlast_PDB 74.3449%-109 - C1 -4JWT ? A:[24-250] --KIAIMGAMPEEISPILEKIG-SYKSTSYAGNKYYEATYQGVELVIAYSKIGKVFSALSAATMIEHFGATKLLFSGVAGAISTNLKVGDLIVATKLSQHDLDITAFGHPYGYVP-EGSVFVEADKDMIELSKK-VALE-MGKSVQEGIIATGDQFVA-----NEE-----RKNWIGTTF-GA-DALEMEGGSVGVVCNALNIPFFILRSISDAADMDASFSFDEFLESSAKESAE----FIMKMVDEL
73 PsiBlast_CBE 68.5531%-104 - C1 -4G41 ? A:[7-234] --KIGIIAAMEEELSLLLANL-LDAQEHQVLSKTYYTGRFGKHELILVQSGVGKVMSAMTVAILVEHFKAQAIINTGSAGAVASHLAIGDVVVADRLVYHDVDATAFGYAYGQMA-GQPLYYDCDPQFVAIFKQ-VLKH-EKTNGQVGLIATGDSFVA-----GQD-----KIDQIKTAFSNV-LAVEMEGAAIAQAAHTAGKPFIVVRAMSDTAAHDANITFDQFIIEAGKRSAQ----ILMTFLENL
14 PsiBlast_PDB 68.3735%-101 - C1 -4GMH MTNN_STAAM A:[4-230] ---IGIIGAMEEEVT-ILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIP-QMPVAFQSSKPLIEKVSQ-VVQQ-QQLTAKVGLIVSGDSFIG-----SVE-----QRQKIKKAFPNA-MAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEMSFEAFLEKAAVSSSQ----TVEALVSQL
72 PsiBlast_CBE 68.2931%-100 - C1 -4G41 ? B:[7-234] --KIGIIAAMEEELSLLLANL-LDAQEHQVLSKTYYTGRFGKHELILVQSGVGKVMSAMTVAILVEHFKAQAIINTGSAGAVASHLAIGDVVVADRLVYHDVDATAFGYAYGQMA-GQPLYYDCDPQFVAIFKQ-VLKH-EKTNGQVGLIATGDSFVA-----GQD-----KIDQIKTAFSNV-LAVEMEGAAIAQAAHTAGKPFIVVRAMSDTAAHDANITFDQFIIEAGKRSAQ----ILMTFLENL
61 PsiBlast_CBE 67.8734% -96 - C1 -4YML ? A:[2-229] --KIGIIGAMEEEVTLLRDKI-ENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLP-GCPAGFKADDKLIAAAEA-CIAE-LNLNAVRGLIVSGDAFINGSVGLAKI-----RHNFP-----QA-IAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSL----MVESLVQKL
76 HHSearch 67.7136% -97 - C1 -3EEI ? A:[3-233] LKTVAVIGAMEQEIELLREMME-NVKAVSFGRFSAYEGELAGKRMVLALSGIGKVNAAVATAWIIREFAADCVINTGSAGGLGKGLKVGDVVIGTETAHHDVDVTAFGYAWGQVP-QLPARFASDGILIEAAKR-AARTFEGAAVEQGLIVSGDRFVH-----SSE-----GVAEIRKHFPEV-KAVEMEAAAIAQTCHQLETPFVIIRAVSDSADEKADISFDEFLKTAAANSAK----MVAEIVKSL
47 PsiBlast_CBE 67.6334%-101 - C1 -4F1W ? A:[18-245] --KIGIIGAMEEEVTLLRDKID-NRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDETRYHDADVTAFGYEYGQLP-GCPAGFKADDKLIAAAES-CIRE-LNLNAVRGLIVSGDAFINGSVGLAKI-----RHNFP-----DA-VAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSTL----MVETLVQKL
25 PsiBlast_CBE 67.5236%-102 - C1 -3EEI ? B:[3-233] LKTVAVIGAMEQEIELLREMME-NVKAVSFGRFSAYEGELAGKRMVLALSGIGKVNAAVATAWIIREFAADCVINTGSAGGLGKGLKVGDVVIGTETAHHDVDVTAFGYAWGQVP-QLPARFASDGILIEAAKR-AARTFEGAAVEQGLIVSGDRFVH-----SSEGVAEIRKHF--PEV-K---AVEMEAAAIAQTCHQLETPFVIIRAVSDSADEKADISFDEFLKTAAANSAK----MVAEIVKSL
17 PsiBlast_PDB 67.3336% -98 - C1 -3EEI ? A:[3-233] LKTVAVIGAMEQEIELLREMME-NVKAVSFGRFSAYEGELAGKRMVLALSGIGKVNAAVATAWIIREFAADCVINTGSAGGLGKGLKVGDVVIGTETAHHDVDVTAFGYAWGQVP-QLPARFASDGILIEAAKR-AARTFEGAAVEQGLIVSGDRFVH-----SSEGVAEIRKHF--PEV-K---AVEMEAAAIAQTCHQLETPFVIIRAVSDSADEKADISFDEFLKTAAANSAK----MVAEIVKSL
75 HHSearch 67.3034% -93 * C1 *3BL6 MTNN_STAAM A:[1-230] AMMIGIIGAMEEEVTILKNKLT-QLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIP-QMPVAFQSSKPLIEKVSQ-VVQQ-QQLTAKVGLIVSGDSFIG-----SVE-----QRQKIKKAFPNA-MAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEMSFEAFLEKAAVSSSQ----TVEALVSQL
39 PsiBlast_CBE 67.1534% -94 - C1 -4F3K ? A:[18-245] --KIGIIGAMEEEVTLLRDKID-NRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDETRYHDADVTAFGYEYGQLP-GCPAGFKADDKLIAAAES-CIRE-LNLNAVRGLIVSGDAFINGSVGLAKI-----RHNFP-----DA-VAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSTL----MVETLVQKL
54 PsiBlast_CBE 67.1434% -96 - C1 -1Y6Q MTNN_ECOLI A:[12-239] --KIGIIGAMEEEVTLLRDKI-ENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLP-GCPAGFKADDKLIAAAEA-CIAE-LNLNAVRGLIVSGDAFINGSVGLAKI-----RHNFP-----QA-IAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSL----MVESLVQKL
70 PsiBlast_CBE 67.0034% -96 - C1 -1Z5O MTNN_ECOLI B:[12-239] --KIGIIGAMEEEVTLLRDKI-ENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLP-GCPAGFKADDKLIAAAEA-CIAE-LNLNAVRGLIVSGDAFINGSVGLAKI-----RHNFP-----QA-IAVEMEATAIAHVCHNFNVPFVVVRAISNVADQQSHLSFDEFLAVAAKQSSL----MVESLVQKL
62 PsiBlast_CBE 66.9734% -96 - C1 -4WKC ? A:[2-229] --KIGIIGAMEEEVTLLRDKI-ENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLP-GCPAGFKADDKLIAAAEA-CIAE-LNLNAVRGLIVSGDAFINGSVGLAKI-----RHNFP-----QA-IAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSL----MVESLVQKL
44 PsiBlast_CBE 66.9534% -94 - C1 -4F2P ? B:[18-245] --KIGIIGAMEEEVTLLRDKID-NRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDETRYHDADVTAFGYEYGQLP-GCPAGFKADDKLIAAAES-CIRE-LNLNAVRGLIVSGDAFINGSVGLAKI-----RHNFP-----DA-VAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSTL----MVETLVQKL
15 PsiBlast_PDB 66.8035% -95 - C1 -3BL6 MTNN_STAAM A:[4-230] ---IGIIGAMEEEVT-ILKNKLTQLSEISVAHVKFYTGILKDREVVITQSGIGKVNAAISTTLLINKFKPDVIINTGSAGALDESLNVGDVLISDDVKYHDADATAFGYEYGQIP-QMPVAFQSSKPLIEKVSQ-VVQQ-QQLTAKVGLIVSGDSFIG-----SVE-----QRQKIKKAFPNA-MAVEMEATAIAQTCYQFNVPFVVVRAVSDLANGEAEMSFEAFLEKAAVSSSQ----TVEALVSQL
45 PsiBlast_CBE 66.7734% -94 - C1 -4F2P ? A:[18-245] --KIGIIGAMEEEVTLLRDKID-NRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDETRYHDADVTAFGYEYGQLP-GCPAGFKADDKLIAAAES-CIRE-LNLNAVRGLIVSGDAFINGSVGLAKI-----RHNFP-----DA-VAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSTL----MVETLVQKL
51 PsiBlast_CBE 66.6734% -97 - C1 -1Y6R MTNN_ECOLI B:[12-239] --KIGIIGAMEEEVTLLRDKI-ENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLP-GCPAGFKADDKLIAAAEA-CIAE-LNLNAVRGLIVSGDAFINGSVGLAKI-----RHNFP-----QA-IAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSL----MVESLVQKL
66 PsiBlast_CBE 66.5934% -98 - C1 -1Z5N MTNN_ECOLI A:[12-239] --KIGIIGAMEEQVTLLRDKI-ENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLP-GCPAGFKADDKLIAAAEA-CIAE-LNLNAVRGLIVSGDAFINGSVGLAKI-----RHNFP-----QA-IAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSL----MVESLVQKL
50 PsiBlast_CBE 66.4034%-102 - C1 -1Z5P MTNN_ECOLI A:[12-239] --KIGIIGAMEEEVTLLRDKI-ENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLP-GCPAGFKADDKLIAAAEA-CIAE-LNLNAVRGLIVSGDAFINGSVGLAKI-----RHNFP-----QA-IAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSL----MVESLVQKL
42 PsiBlast_CBE 66.3634% -91 - C1 -4F2W ? B:[18-245] --KIGIIGAMEEEVTLLRDKID-NRQTITLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLASTLKVGDIVVSDETRYHDADVTAFGYEYGQLP-GCPAGFKADDKLIAAAES-CIRE-LNLNAVRGLIVSGDAFINGSVGLAKI-----RHNFP-----DA-VAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSTL----MVETLVQKL
71 PsiBlast_CBE 66.2834% -95 - C1 -1Z5O MTNN_ECOLI A:[12-239] --KIGIIGAMEEEVTLLRDKI-ENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLP-GCPAGFKADDKLIAAAEA-CIAE-LNLNAVRGLIVSGDAFINGSVGLAKI-----RHNFP-----QA-IAVEMEATAIAHVCHNFNVPFVVVRAISNVADQQSHLSFDEFLAVAAKQSSL----MVESLVQKL
58 PsiBlast_CBE 66.2634% -94 - C1 -1NC1 MTNN_ECOLI A:[12-239] --KIGIIGAMEEEVTLLRDKI-ENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLP-GCPAGFKADDKLIAAAEA-CIAE-LNLNAVRGLIVSGDAFINGSVGLAKI-----RHNFP-----QA-IAVEMEATAIAHVCHNFNVPFVVVRAISDVADQQSHLSFDEFLAVAAKQSSL----MVESLVQKL
52 PsiBlast_CBE 65.9234% -94 - C1 -1Y6R MTNN_ECOLI A:[12-239] --KIGIIGAMEEEVTLLRDKI-ENRQTISLGGCEIYTGQLNGTEVALLKSGIGKVAAALGATLLLEHCKPDVIINTGSAGGLAPTLKVGDIVVSDEARYHDADVTAFGYEYGQLP-GCPAGF