@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : jhp_0181: (2015-12-13 )
MGFLKGKKGLIVGVANNKSIAYGIAQSCFNQGATLAFTYLNESLEKRVRPIAQELNSPYVYELDVSKEEHFKSLYNNIKQDLGSLDFIVHSVAFAPKEALEGSLLETSKSAFNTAMEISVYSLIELTNTLKPLLNNGASVLTLSYLGSTKYMAHYNVMGLAKAALESAVRYLAVDLGKHNIRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKNVSLEEVGNAGMYLLSSLSNGVSGEVHFVDAGYHVMGMGAVEEKDNKATLLWDLHKEQ

Atome Classification :

(70 SA) .........10........20........30.........40........50....--..--..60-----------........70........80...-.....90........100....-.---..110.......120.......130..--.-.---...140.......150...--....160.......170......-.180.......190.......200.......210......---.220.......230.-......240.......250-........260.......270...
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MGFLKGKKGLIVGVANNKSIAYGIAQSCFN-QGATLAFTYLNESLEKRVRPIAQEL--NS--PYVY-----------ELDVSKEEHFKSLYNNIKQDLGS-LDFIVHSVAFAPKEALEGSLLE-T---SKSAFNTAMEISVYSLIELTNTLKPLL--N-N---GASVLTLSYLGSTKYMAHY--NVMGLAKAALESAVRYLAVDLGK-HNIRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKN---VSLEEVGNAGMYLLS-SLSNGVSGEVHFVDAGYH--VMGMGAVEEKDNKATLLWDLHKEQ
22 PsiBlast_CBE 95.8198%-119 - C1 -2PD4 FABI_HELPY C:[2-275] -GFLKGKKGLIVGVANNKSIAYGIAQSCFN-QGATLAFTYLNESLEKRVRPIAQEL--NS--PYVY-----------ELDVSKEEHFKSLYNSVKKDLGS-LDFIVHSVAFAPKEALEGSLLE-T---SKSAFNTAMEISVYSLIELTNTLKPLL--N-N---GASVLTLSYLGSTKYMAHY--NVMGLAKAALESAVRYLAVDLGK-HHIRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKN---VSLEEVGNAGMYLLS-SLSSGVSGEVHFVDAGYH--VMGMGAVEEKDNKATLLWDLHKEQ
21 PsiBlast_CBE 95.6898%-120 - C1 -2PD4 FABI_HELPY D:[2-275] -GFLKGKKGLIVGVANNKSIAYGIAQSCFN-QGATLAFTYLNESLEKRVRPIAQEL--NS--PYVY-----------ELDVSKEEHFKSLYNSVKKDLGS-LDFIVHSVAFAPKEALEGSLLE-T---SKSAFNTAMEISVYSLIELTNTLKPLL--N-N---GASVLTLSYLGSTKYMAHY--NVMGLAKAALESAVRYLAVDLGK-HHIRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKN---VSLEEVGNAGMYLLS-SLSSGVSGEVHFVDAGYH--VMGMGAVEEKDNKATLLWDLHKEQ
23 PsiBlast_CBE 95.5998%-121 - C1 -2PD4 FABI_HELPY B:[2-275] -GFLKGKKGLIVGVANNKSIAYGIAQSCFN-QGATLAFTYLNESLEKRVRPIAQEL--NS--PYVY-----------ELDVSKEEHFKSLYNSVKKDLGS-LDFIVHSVAFAPKEALEGSLLE-T---SKSAFNTAMEISVYSLIELTNTLKPLL--N-N---GASVLTLSYLGSTKYMAHY--NVMGLAKAALESAVRYLAVDLGK-HHIRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKN---VSLEEVGNAGMYLLS-SLSSGVSGEVHFVDAGYH--VMGMGAVEEKDNKATLLWDLHKEQ
1 PsiBlast_PDB 95.4898%-118 - C1 -2PD3 FABI_HELPY A:[2-275] -GFLKGKKGLIVGVANNKSIAYGIAQSCFN-QGATLAFTYLNESLEKRVRPIAQEL--NS--PYVY-----------ELDVSKEEHFKSLYNSVKKDLGS-LDFIVHSVAFAPKEALEGSLLE-T---SKSAFNTAMEISVYSLIELTNTLKPLL--N-N---GASVLTLSYLGSTKYMAHY--NVMGLAKAALESAVRYLAVDLGK-HHIRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKN---VSLEEVGNAGMYLLS-SLSSGVSGEVHFVDAGYH--VMGMGAVEEKDNKATLLWDLHKEQ
111 HHSearch 95.1898%-118 - C1 -2PD4 FABI_HELPY A:[2-275] -GFLKGKKGLIVGVANNKSIAYGIAQSCFN-QGATLAFTYLNESLEKRVRPIAQEL--NS--PYVY-----------ELDVSKEEHFKSLYNSVKKDLGS-LDFIVHSVAFAPKEALEGSLLE-T---SKSAFNTAMEISVYSLIELTNTLKPLL--N-N---GASVLTLSYLGSTKYMAHY--NVMGLAKAALESAVRYLAVDLGK-HHIRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKN---VSLEEVGNAGMYLLS-SLSSGVSGEVHFVDAGYH--VMGMGAVEEKDNKATLLWDLHKEQ
2 PsiBlast_PDB 95.1898%-118 - C1 -2PD4 FABI_HELPY A:[2-275] -GFLKGKKGLIVGVANNKSIAYGIAQSCFN-QGATLAFTYLNESLEKRVRPIAQEL--NS--PYVY-----------ELDVSKEEHFKSLYNSVKKDLGS-LDFIVHSVAFAPKEALEGSLLE-T---SKSAFNTAMEISVYSLIELTNTLKPLL--N-N---GASVLTLSYLGSTKYMAHY--NVMGLAKAALESAVRYLAVDLGK-HHIRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKN---VSLEEVGNAGMYLLS-SLSSGVSGEVHFVDAGYH--VMGMGAVEEKDNKATLLWDLHKEQ
24 PsiBlast_CBE 95.1498%-117 - C1 -2PD3 FABI_HELPY D:[2-275] -GFLKGKKGLIVGVANNKSIAYGIAQSCFN-QGATLAFTYLNESLEKRVRPIAQEL--NS--PYVY-----------ELDVSKEEHFKSLYNSVKKDLGS-LDFIVHSVAFAPKEALEGSLLE-T---SKSAFNTAMEISVYSLIELTNTLKPLL--N-N---GASVLTLSYLGSTKYMAHY--NVMGLAKAALESAVRYLAVDLGK-HHIRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKN---VSLEEVGNAGMYLLS-SLSSGVSGEVHFVDAGYH--VMGMGAVEEKDNKATLLWDLHKEQ
25 PsiBlast_CBE 94.9998%-118 - C1 -2PD3 FABI_HELPY C:[2-275] -GFLKGKKGLIVGVANNKSIAYGIAQSCFN-QGATLAFTYLNESLEKRVRPIAQEL--NS--PYVY-----------ELDVSKEEHFKSLYNSVKKDLGS-LDFIVHSVAFAPKEALEGSLLE-T---SKSAFNTAMEISVYSLIELTNTLKPLL--N-N---GASVLTLSYLGSTKYMAHY--NVMGLAKAALESAVRYLAVDLGK-HHIRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKN---VSLEEVGNAGMYLLS-SLSSGVSGEVHFVDAGYH--VMGMGAVEEKDNKATLLWDLHKEQ
26 PsiBlast_CBE 93.4798%-116 - C1 -2PD3 FABI_HELPY B:[2-275] -GFLKGKKGLIVGVANNKSIAYGIAQSCFN-QGATLAFTYLNESLEKRVRPIAQEL--NS--PYVY-----------ELDVSKEEHFKSLYNSVKKDLGS-LDFIVHSVAFAPKEALEGSLLE-T---SKSAFNTAMEISVYSLIELTNTLKPLL--N-N---GASVLTLSYLGSTKYMAHY--NVMGLAKAALESAVRYLAVDLGK-HHIRVNALSAGPIRTLASSGIADFRMILKWNEINAPLRKN---VSLEEVGNAGMYLLS-SLSSGVSGEVHFVDAGYH--VMGMGAVEEKDNKATLLWDLHKEQ
4 PsiBlast_PDB 82.6052%-119 - C1 -3K2E ? A:[27-282] --LMEGKKGVIIGVANDKSLAWGIAKAVCA-QGAEVALTYLSETFKKRVDPLAESL--GV--KLTV-----------PCDVSDAESVDNMFKVLAEEWGS-LDFVVHAVAFSDKNELKGRYVD-T---SLGNFLTSMHISCYSFTYIASKAEPLM--T-N---GGSILTLSYYGAEKVVPHY--NVMGVCKAALEASVKYLAVDLGK-QQIRVNAISAGPVRTLASSGISDFHYILTWNKYNSPLRRN---TTLDDVGGAALYLLS-DLGRGTTGETVHVDCGYH--VVGMKSV-----------------
5 PsiBlast_PDB 82.1152%-122 - C1 -3K31 ? A:[27-282] --LMEGKKGVIIGVANDKSLAWGIAKAVCA-QGAEVALTYLSETFKKRVDPLAESL--GV--KLTV-----------PCDVSDAESVDNMFKVLAEEWGS-LDFVVHAVAFSDKNELKGRYVD-T---SLGNFLTSMHISCYSFTYIASKAEPLM--T-N---GGSILTLSYYGAEKVVPHY--NVMGVCKAALEASVKYLAVDLGK-QQIRVNAISAGPVRTLASSGISDFHYILTWNKYNSPLRRN---TTLDDVGGAALYLLS-DLGRGTTGETVHVDCGYH--VVGMKSV-----------------
3 PsiBlast_PDB 80.8753%-118 - C1 -3GRK - ? A:[6-259] -GLLQGKRGLILGVANNRSIAWGIAKAARE-AGAELAFTYQGDALKKRVEPLAEEL--GA--FVAG-----------HCDVADAASIDAVFETLEKKWGK-LDFLVHAIGFSDKDELTGRYID-T---SEANFTNTMLISVYSLTAVSRRAEKLM--A-D---GGSILTLTYYGAEKVMPNY--NVMGVAKAALEASVKYLAVDLGP-QNIRVNAISAGPIKT------GDFRYILKWNEYNAPLRRT---VTIDEVGDVGLYFLS-DLSRSVTGEVHHADSGYH--VIGM--------------------
28 PsiBlast_CBE 80.5552%-115 - C1 -3K2E ? B:[27-286] --LMEGKKGVIIGVANDKSLAWGIAKAVCA-QGAEVALTYLSETFKKRVDPLAESL--GV--KLTV-----------PCDVSDAESVDNMFKVLAEEWGS-LDFVVHAVAFSDKNELKGRYVD-T---SLGNFLTSMHISCYSFTYIASKAEPLM--T-N---GGSILTLSYYGAEKVVPHY--NVMGVCKAALEASVKYLAVDLGK-QQIRVNAISAGPVR-------SDFHYILTWNKYNSPLRRN---TTLDDVGGAALYLLS-DLGRGTTGETVHVDCGYH--VVGMKSVDAPDI------------
27 PsiBlast_CBE 80.4852%-115 - C1 -3K31 ? B:[27-286] --LMEGKKGVIIGVANDKSLAWGIAKAVCA-QGAEVALTYLSETFKKRVDPLAESL--GV--KLTV-----------PCDVSDAESVDNMFKVLAEEWGS-LDFVVHAVAFSDKNELKGRYVD-T---SLGNFLTSMHISCYSFTYIASKAEPLM--T-N---GGSILTLSYYGAEKVVPHY--NVMGVCKAALEASVKYLAVDLGK-QQIRVNAISAGPVR-------SDFHYILTWNKYNSPLRRN---TTLDDVGGAALYLLS-DLGRGTTGETVHVDCGYH--VVGMKSVDAPDI------------
29 PsiBlast_CBE 79.6149%-117 - C1 -4M89 ? B:[2-254] -GFLQGKKILITGMISERSIAYGIAKACRE-QGAELAFTYVVDKLEERVRKMAAEL--DS--ELVF-----------RCDVASDDEINQVFADLGKHWDG-LDGLVHSIGFAPKEALSGDFLD-SI--SREAFNTAHEISAYSLPALAKAARPMM--RGR---NSAIVALSYLGAVRAIPNY--NVMGMAKASLEAGIRFTAACLGK-EGIRCNGISAGPIKTLAASGIADFGKLLGHVAAHNPLRRN---VTIEEVGNTAAFLLS-DLSSGITGEITYVDGGYS--INALS-------------------
63 PsiBlast_CBE 79.5346%-119 - C1 -3PJD FABI_ECOLI A:[2-256] -GFLSGKRILVTGVASKLSIAYGIAQAMHR-EGAELAFTYQNDKLKGRVEEFAAQL--GS--DIVL-----------QCDVAEDASIDTMFAELGKVWPK-FDGFVHSIAFAPGDQLDGDYVNAV---TREGFKIAHDISSYSFVAMAKACRSML--N-P---GSALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFS--IAAMNE------------------
40 PsiBlast_CBE 79.4544%-118 - C1 -2WYV ? D:[6-257] ---LSGKKALVMGVTNQRSLGFAIAAKLKE-AGAEVALSYQAERLRPEAEKLAEAL--GG--ALLF-----------RADVTQDEELDALFAGVKEAFGG-LDYLVHAIAFAPREAMEGRYID-T---RRQDWLLALEVSAYSLVAVARRAEPLL--R-E---GGGIVTLTYYASEKVVPKY--NVMAIAKAALEASVRYLAYELGP-KGVRVNAISAGPVRTVAARSIPGFTKMYDRVAQTAPLRRN---ITQEEVGNLGLFLLS-PLASGITGEVVYVDAGYH--IMGM--------------------
8 PsiBlast_PDB 79.4349%-117 - C1 -4M89 ? A:[2-254] -GFLQGKKILITGMISERSIAYGIAKACRE-QGAELAFTYVVDKLEERVRKMAAEL--DS--ELVF-----------RCDVASDDEINQVFADLGKHWDG-LDGLVHSIGFAPKEALSGDFLD-SI--SREAFNTAHEISAYSLPALAKAARPMM--RGR---NSAIVALSYLGAVRAIPNY--NVMGMAKASLEAGIRFTAACLGK-EGIRCNGISAGPIKTLAASGIADFGKLLGHVAAHNPLRRN---VTIEEVGNTAAFLLS-DLSSGITGEITYVDGGYS--INALS-------------------
58 PsiBlast_CBE 79.4247%-117 - C1 -4NR0 FABI_PSEAE D:[2-262] -GFLTGKRALIVGVASKLSIASGIAAAMHR-EGAELAFTYQNDKLRGRVEEFASGW--GSRPELCF-----------PCDVADDSQIEAVFAALGKHWDG-LDIIVHSVGFAPGDQLDGDFTAVT---TREGFRIAHDISAYSFIALAKAGREMMKGR-N---G-SLLTLSYLGAERTMPNY--NVMGMAKASLEAGVRYLAGSLGA-EGTRVNAVSAGPIRTLAASGIKSFRKMLAANERQTPLRRN---VTIEEVGNAGAFLCS-DLASGISGEILYVDGGFN--TTAMGPL-----------------
30 PsiBlast_CBE 79.2649%-122 - C1 -4M87 ? B:[2-254] -GFLQGKKILITGMISERSIAYGIAKACRE-QGAELAFTYVVDKLEERVRKMAAEL--DS--ELVF-----------RCDVASDDEINQVFADLGKHWDG-LDGLVHSIGFAPKEALSGDFLD-SI--SREAFNTAHEISAYSLPALAKAARPMM--RGR---NSAIVALSYLGAVRAIPNY--NVMGMAKASLEAGIRFTAACLGK-EGIRCNGISAGPI-----------GKLLGHVAAHNPLRRN---VTIEEVGNTAAFLLS-DLSSGITGEITYVDGGYS--INALS-------------------
9 PsiBlast_PDB 79.1349%-119 - C1 -4M87 ? A:[2-254] -GFLQGKKILITGMISERSIAYGIAKACRE-QGAELAFTYVVDKLEERVRKMAAEL--DS--ELVF-----------RCDVASDDEINQVFADLGKHWDG-LDGLVHSIGFAPKEALSGDFLD-SI--SREAFNTAHEISAYSLPALAKAARPMM--RGR---NSAIVALSYLGAVRAIPNY--NVMGMAKASLEAGIRFTAACLGK-EGIRCNGISAGPIKTLAASGIADFGKLLGHVAAHNPLRRN---VTIEEVGNTAAFLLS-DLSSGITGEITYVDGGYS--INALS-------------------
99 PsiBlast_CBE 79.0845%-118 - C1 -1QG6 FABI_ECOLI A:[1-257] -GFLSGKRILVTGVASKLSIAYGIAQAMHR-EGAELAFTYQNDKLKGRVEEFAAQL--GS--DIVL-----------QCDVAEDASIDTMFAELGKVWPK-FDGFVHSIGFAPGDQLDGDYVNAV---TREGFKIAHDISSYSFVAMAKACRSML--N-P---GSALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFS--IAAMNE------------------
97 PsiBlast_CBE 79.0545%-118 - C1 -1QG6 FABI_ECOLI C:[1-257] -GFLSGKRILVTGVASKLSIAYGIAQAMHR-EGAELAFTYQNDKLKGRVEEFAAQL--GS--DIVL-----------QCDVAEDASIDTMFAELGKVWPK-FDGFVHSIGFAPGDQLDGDYVNAV---TREGFKIAHDISSYSFVAMAKACRSML--N-P---GSALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFS--IAAMNE------------------
62 PsiBlast_CBE 78.8646%-119 - C1 -3PJD FABI_ECOLI B:[2-256] -GFLSGKRILVTGVASKLSIAYGIAQAMHR-EGAELAFTYQNDKLKGRVEEFAAQL--GS--DIVL-----------QCDVAEDASIDTMFAELGKVWPK-FDGFVHSIAFAPGDQLDGDYVNAV---TREGFKIAHDISSYSFVAMAKACRSML--N-P---GSALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFS--IAAMNE------------------
59 PsiBlast_CBE 78.7847%-115 - C1 -4NR0 FABI_PSEAE C:[2-262] -GFLTGKRALIVGVASKLSIASGIAAAMHR-EGAELAFTYQNDKLRGRVEEFASGW--GSRPELCF-----------PCDVADDSQIEAVFAALGKHWDG-LDIIVHSVGFAPGDQLDGDFTAVT---TREGFRIAHDISAYSFIALAKAGREMMKGR-N---G-SLLTLSYLGAERTMPNY--NVMGMAKASLEAGVRYLAGSLGA-EGTRVNAVSAGPIRTLAASGIKSFRKMLAANERQTPLRRN---VTIEEVGNAGAFLCS-DLASGISGEILYVDGGFN--TTAMGPL-----------------
98 PsiBlast_CBE 78.6945%-118 - C1 -1QG6 FABI_ECOLI B:[1-257] -GFLSGKRILVTGVASKLSIAYGIAQAMHR-EGAELAFTYQNDKLKGRVEEFAAQL--GS--DIVL-----------QCDVAEDASIDTMFAELGKVWPK-FDGFVHSIGFAPGDQLDGDYVNAV---TREGFKIAHDISSYSFVAMAKACRSML--N-P---GSALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFS--IAAMNE------------------
61 PsiBlast_CBE 78.4947%-114 - C1 -4NR0 FABI_PSEAE A:[2-260] -GFLTGKRALIVGVASKLSIASGIAAAMHR-EGAELAFTYQNDKLRGRVEEFASGW--GSRPELCF-----------PCDVADDSQIEAVFAALGKHWDG-LDIIVHSVGFAPGDQLDGDFTAVT---TREGFRIAHDISAYSFIALAKAGREMMKGR-N---G-SLLTLSYLGAERTMPNY--NVMGMAKASLEAGVRYLAGSLGA-EGTRVNAVSAGPIRTLAASGIKSFRKMLAANERQTPLRRN---VTIEEVGNAGAFLCS-DLASGISGEILYVDGGFN--TTAMG-------------------
87 PsiBlast_CBE 78.4645%-120 - C1 -3PJE FABI_ECOLI A:[2-256] -GFLSGKRILVTGVASKLSIAYGIAQAMHR-EGAELAFTYQNDKLKGRVEEFAAQL--GS--DIVL-----------QCDVAEDASIDTMFAELGKVWPK-FDGFVHSISFAPGDQLDGDYVNAV---TREGFKIAHDISSYSFVAMAKACRSML--N-P---GSALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFS--IAAMNE------------------
96 PsiBlast_CBE 78.4345%-118 - C1 -1QG6 FABI_ECOLI D:[1-257] -GFLSGKRILVTGVASKLSIAYGIAQAMHR-EGAELAFTYQNDKLKGRVEEFAAQL--GS--DIVL-----------QCDVAEDASIDTMFAELGKVWPK-FDGFVHSIGFAPGDQLDGDYVNAV---TREGFKIAHDISSYSFVAMAKACRSML--N-P---GSALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFS--IAAMNE------------------
88 PsiBlast_CBE 78.3945%-118 - C1 -4D46 ? B:[2-256] -GFLSGKRILVTGVASKLSIAYGIAQAMHR-EGAELAFTYQNDKLKGRVEEFAAQL--GS--DIVL-----------QCDVAEDASIDTMFAELGKVWPK-FDGFVHSIGFAPGDQLDGDYVNAV---TREGFKIAHDISSYSFVAMAKACRSML--N-P---GSALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPIRTLAASGIKDF------CEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFS--IAAM--------------------
37 PsiBlast_CBE 78.3944%-118 - C1 -2WYW ? D:[6-257] ---LSGKKALVMGVTNQRSLGFAIAAKLKE-AGAEVALSYQAERLRPEAEKLAEAL--GG--ALLF-----------RADVTQDEELDALFAGVKEAFGG-LDYLVHAIAFAPREAMEGRYID-T---RRQDWLLALEVSAYSLVAVARRAEPLL--R-E---GGGIVTLTYYASEKVVPKY--NVMAIAKAALEASVRYLAYELGP-KGVRVNAISAGPVRTVAARSIPGFTKMYDRVAQTAPLRRN---ITQEEVGNLGLFLLS-PLASGITGEVVYVDAGYH--IMGME-------------------
83 PsiBlast_CBE 78.3045%-118 - C1 -1C14 FABI_ECOLI A:[2-257] -GFLSGKRILVTGVASKLSIAYGIAQAMHR-EGAELAFTYQNDKLKGRVEEFAAQL--GS--DIVL-----------QCDVAEDASIDTMFAELGKVWPK-FDGFVHSIGFAPGDQLDGDYVNAV---TREGFKIAHDISSYSFVAMAKACRSML--N-P---GSALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFS--IAAMN-------------------
32 PsiBlast_CBE 78.2745%-114 - C1 -3OJF FABI_BACCR D:[2-257] -ELLQGKTFVVMGVANQRSIAWGIARSLHN-AGAKLIFTYAGERLERNVRELADTLEGQE--SLVL-----------PCDVTNDEELTACFETIKQEVGT-IHGVAHCIAFANRDDLKGEFVD-T---SRDGFLLAQNISAFSLTAVAREAKKVM--T-E---GGNILTLTYLGGERVVKNY--NVMGVAKASLEASVKYLANDLGQ-HGIRVNAISAGPIRTLSAKGVGDFNSILREIEERAPLRRT---TTQEEVGDTAVFLFS-DLARGVTGENIHVDSGYH--ILGL--------------------
91 PsiBlast_CBE 78.0345%-122 - C1 -4CV3 ? A:[2-256] -GFLSGKRILVTGVASKLSIAYGIAQAMHR-EGAELAFTYQNDKLKGRVEEFAAQL--GS--DIVL-----------QCDVAEDASIDTMFAELGKVWPK-FDGFVHSIGFAPGDQLDGDYVNAV---TREGFKIAHDISSYSFVAMAKACRSML--N-P---GSALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPI-----------------CEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFS--IAAMN-------------------
57 PsiBlast_CBE 77.9945%-111 - C1 -2QIO ? A:[1-256] MELLQGKTFVVMGVANQRSIAWGIARSLHN-AGAKLIFTYAGERLERNVRELADTLEGQE--SLVL-----------PCDVTNDEELTACFETIKQEVGT-IHGVAHCIAFANRDDLKGEFVD-T---SRDGFLLAQNISAFSLTAVAREAKKVM--T-E---GGNILTLTYLGGERVVKNY--NVMGVAKASLEASVKYLANDLGQ-HGIRVNAISAGPIRTLSAKGVGDFNSILREIEERAPLRRT---TTQEEVGDTAVFLFS-DLARGVTGENIHVDSGYH--ILG---------------------
90 PsiBlast_CBE 77.9645%-122 - C1 -4CV3 ? B:[2-256] -GFLSGKRILVTGVASKLSIAYGIAQAMHR-EGAELAFTYQNDKLKGRVEEFAAQL--GS--DIVL-----------QCDVAEDASIDTMFAELGKVWPK-FDGFVHSIGFAPGDQLDGDYVNAV---TREGFKIAHDISSYSFVAMAKACRSML--N-P---GSALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPI-----------------CEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFS--IAAMN-------------------
54 PsiBlast_CBE 77.9345%-109 - C1 -2QIO ? D:[1-256] MELLQGKTFVVMGVANQRSIAWGIARSLHN-AGAKLIFTYAGERLERNVRELADTLEGQE--SLVL-----------PCDVTNDEELTACFETIKQEVGT-IHGVAHCIAFANRDDLKGEFVD-T---SRDGFLLAQNISAFSLTAVAREAKKVM--T-E---GGNILTLTYLGGERVVKNY--NVMGVAKASLEASVKYLANDLGQ-HGIRVNAISAGPIRTLSAKGVGDFNSILREIEERAPLRRT---TTQEEVGDTAVFLFS-DLARGVTGENIHVDSGYH--ILG---------------------
81 PsiBlast_CBE 77.8945%-118 - C1 -1I2Z FABI_ECOLI A:[2-258] -GFLSGKRILVTGVASKLSIAYGIAQAMHR-EGAELAFTYQNDKLKGRVEEFAAQL--GS--DIVL-----------QCDVAEDASIDTMFAELGKVWPK-FDGFVHSIGFAPGDQLDGDYVNAV---TREGFKIAHDISSYSFVAMAKACRSML--N-P---GSALLTLSYLGAERAIPNY--NVMGLAKASLEANVRYMANAMGP-EGVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRT---VTIEDVGNSAAFLCS-DLSAGISGEVVHVDGGFS--IAAMNE------------------
42 PsiBlast_CBE 77.8844%-114 - C1 -2WYV ? B:[6-257] ---LSGKKALVMGVTNQRSLGFAIAAKLKE-AGAEVALSYQAERLRPEAEKLAEAL--GG--ALLF-----------RADVTQDEELDALFAGVKEAFGG-LDYLVHAIAFAPREAMEGRYID-T---RRQDWLLALEVSAYSLVAVARRAEPLL--R-E---GGGIVTLTYYASEKVVPKY--NVMAIAKAALEASVRYLAYELGP-KGVRVNAISAGPVRT------------YDRVAQTAPLRRN---ITQEEVGNLGLFLLS-PLASGITGEVVYVDAGYH--IMGMEL------------------