@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : jhp_0266: (2015-12-14 )
MDFQLQAVDDNARAGVLNLAHSQVETPVFMPVGTQGCIKSLDAMDAQEILGAKLILANTYHMYLRPGEKVVEQLGGLHRFAQFQGSFLTDSGGFQAFSLSDNVKLQEDGIVFKSHIDGSKHLFTPIKVLDIQYSLNSDIMMVLDDLVGLPAPLKRLEESIKRSAKWANMSLEYHKENNRPNNNLFAIIQGGTHLKMRSLSVGLTHEGFDGYAIGGLAVGESVDEMLETIAHTAPLLPKDKPRYLMGVGTPENILDAISLGVDMFDCVMPTRNARNATLFTHSGKISIKNAPYKLDDTPIEENCACYACKRYSKAYLHHLFRAKELTYARLASLHNLHFYLELVKNARNAILEKRFLSFKKEFLEKYHSCSH

Atome Classification :

(43 SA) ---.........10........20........30........40........50........60........70........80........90........100.......110.......120.......130.......140.......150.......160.......170.--......180.--......190.......200.....-...210.......220--........230.......240.......250.......260.......270.......280.......290.......300.......310.......320.......330.......340.......350.......360.......370
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) ---MDFQLQAVDDNARAGVLNLAHSQVETPVFMPVGTQGCIKSLDAMDAQEILGAKLILANTYHMYLRPGEKVVEQLGGLHRFAQFQGSFLTDSGGFQAFSLSDNVKLQEDGIVFKSHIDGSKHLFTPIKVLDIQYSLNSDIMMVLDDLVGLPAPLKRLEESIKRSAKWANMSLEY--HKENNRPNNN--LFAIIQGGTHLKMRSLSV-GLTHE-GFDGYAIGGLAVGES---VDEMLETIAHTAPLLPKDKPRYLMGVGTPENILDAISLGVDMFDCVMPTRNARNATLFTHSGKISIKNAPYKLDDTPIEENCACYACKRYSKAYLHHLFRAKELTYARLASLHNLHFYLELVKNARNAILEKRFLSFKKEFLEKYHSCSH
39 PsiBlast_CBE 97.1743% -94 - C4 -3SM0 TGT_ZYMMO A:[16-381] -----FSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKP-ETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGYQVMSL---TKQSEEGVTFK-----SRHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFDSRKEQAENAA--LFGIQQGSVFENLRQQSADALAEI-GFDGYAVGGLAVGEG---QDEMFRVLDFSVPMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRARYF----
19 PsiBlast_PDB 96.7843% -89 - C4 -1S38 TGT_ZYMMO A:[16-381] -----FSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKP-ETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGYQVMSL---TKQSEEGVTFK-----SRHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFDSRKEQAENAA--LFGIQQGSVFENLRQQSADALAEI-GFDGYAVGGLAVGEG---QDEMFRVLDFSVPMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRARYF----
14 PsiBlast_PDB 96.5443% -88 - C4 -1P0B TGT_ZYMMO A:[16-381] -----FSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKP-ETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGYQVMSLSSLTKQSEEGVTFKSH----RHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFDSRKEQAENAA--LFGIQQGSVFENLRQQSADALAEI-GFDGYAVGGLAVGEG---QDEMFRVLDFSVPMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRARYFA---
58 PsiBlast_CBE 96.4543% -88 - C4 -4LEQ TGT_ZYMMO A:[18-383] -----FSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKP-ETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGYQVMSLSSLTKQSEEGVTFKS-LDGSRHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFDSRKEQAENAA--LFGIQQGSVFENLRQQSADALAEI-GFDGYAVGGLAVGEG---QDEMFRVLDFSVPMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRARYFA---
78 PsiBlast_CBE 96.3543% -89 - C4 -4HSH TGT_ZYMMO A:[15-380] -----FSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKP-ETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGFQVMS----TKQSEEGVTFKSH----RHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFDSRKEQAENAA--LFGIQQGSVFENLRQQSADALAEI-GFDGYAVGGLAGGEG---QDEMFRVLDFSVPMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRARYFA---
57 PsiBlast_CBE 96.3243% -88 - C4 -4Q8V TGT_ZYMMO A:[18-383] -----FSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKP-ETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGYQVMSLSSLTKQSEEGVTFKSH---SRHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFDSRKEQAENAA--LFGIQQGSVFENLRQQSADALAEI-GFDGYAVGGLAVGEG---QDEMFRVLDFSVPMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRARYFA---
75 PsiBlast_CBE 96.3143% -87 - C4 -1EFZ TGT_ZYMMO A:[16-381] -----FSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKP-ETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDAGGYQVMSLSSLTKQSEEGVTFKSHLDGSRHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFDSRKEQAENAA--LFGIQQGSVFENLRQQSADALAEI-GFDGYAVGGLAVGEG---QDEMFRVLDFSVPMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRARYF----
87 PsiBlast_CBE 96.3043% -89 - C4 -4DXX TGT_ZYMMO A:[16-381] -----FSIAAREGKARTGTIEMKRGVIRTPAFMPVGT--TVMALKP-ETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGYQVMSLSSLTKQSEEGVTFKSHLDGSRHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFDSRKEQAENAA--LFGIQQGSVFENLRQQSADALAEI-GFDGYAVGGLAVGEG---QDEMFRVLDFSVPMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRARYFA---
27 PsiBlast_CBE 96.2243% -90 - C4 -4Q4O TGT_ZYMMO A:[16-381] -----FSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKP-ETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGYQVMSLSSLTKQSEEGVTFK-----SRHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFDSRKEQAENAA--LFGIQQGSVFENLRQQSADALAEI-GFDGYAVGGLAVGEG---QDEMFRVLDFSVPMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRARYFA---
47 PsiBlast_CBE 96.2143% -87 - C4 -2QII TGT_ZYMMO A:[16-381] -----FSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKP-ETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGYQVMSLSSLTKQSEEGVTFK-----SRHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFDSRKEQAENAA--LFGIQQGSVFENLRQQSADALAEI-GFDGYAVGGLAVGEG---QDEMFRVLDFSVPMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRARYFA---
20 PsiBlast_PDB 96.1543% -91 - C4 -2BBF TGT_ZYMMO A:[16-381] -----FSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKP-ETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGYQVMSL---TKQSEEGVTFKSHL--SRHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFDSRKEQAENAA--LFGIQQGSVFENLRQQSADALAEI-GFDGYAVGGLAVGEG---QDEMFRVLDFSVPMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRARYF----
67 PsiBlast_CBE 96.1143% -89 - C4 -4HQV TGT_ZYMMO A:[15-380] -----FSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKP-ETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGFQVMSLSSLTKQSEEGVTFKSHLDGSRHMLSPERSIEIQHLLGSDIVMAFDEVTPYPATPSRAASSMERSMRWAKRSRDAFDSRKEQAENAA--LFGIQQGSVFENLRQQSADALAEI-GFDGYAVGGLAGGEG---QDEMFRVLDFSVPMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRARYFA---
1 PsiBlast_PDB 96.0843% -91 - C4 -4GD0 TGT_ZYMMO A:[16-381] -----FSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKP-ETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGFQVMSLSSLTKQSEEGVTFKSHLDGSRHMLSPERSIEIQHLLGSDIVMAFDEVTPYPATPSRAASSMERSMRWAKRSRDAFDSRKEQAENAA--LFGIQQGSVFENLRQQSADALAEI-GFDGYAVGGLAVGEG---QDEMFRVLDFSVPMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRARYFA---
82 PsiBlast_CBE 96.0543% -90 - C4 -4Q8M TGT_ZYMMO A:[18-383] -----FSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKP-ETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGYQVMSLSSLTKQSEEGVTFKSHLDGSRHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFDSRKEQAENAA--LFGIQQGSVFENLRQQSADALAEI-GFDGYAVGGLAVGEG---QDEMFRVLDFSVPMLPDDKPHYLMGTGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRARYFA---
59 PsiBlast_CBE 96.0543% -90 - C4 -4LBU TGT_ZYMMO A:[18-383] -----FSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKP-ETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGYQVMSLSSLTKQSEEGVTFK-----SRHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFDSRKEQAENAA--LFGIQQGSVFENLRQQSADALAEI-GFDGYAVGGLAVGEG---QDEMFRVLDFSVPMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRARYFA---
17 PsiBlast_PDB 96.0543% -87 - C4 -1Q65 TGT_ZYMMO A:[16-381] -----FSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKP-ETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGYQVMSL---TKQSEEGVTFKSHLDGSRHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFDSRKEQAENAA--LFGIQQGSVFENLRQQSADALAEI-GFDGYAVGGLAVGEG---QDEMFRVLDFSVPMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRARYF----
91 PsiBlast_CBE 95.9943% -89 * C4 *4Q8P TGT_ZYMMO A:[18-383] -----FSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKP-ETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGYQVMSL---TKQSEEGVTFKSHLDGSRHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFDSRKEQAENAA--LFGIQQGSVFENLRQQSADALAEI-GFDGYAVGGLAVGEG---QDEMFRVLDFSVPMLPDDKPHYLMGDGKPDDIVGAVERGIDMFDCVLPTR--RNGQAFTWDGPINIRNARFSEDLKPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRARYFA---
5 PsiBlast_PDB 95.9643% -87 - C4 -1OZM TGT_ZYMMO A:[16-381] -----FSIAAREGKARTGTIEMKRGVIRTPAFMPVGTAATVKALKP-ETVRATGADIILGNTYHLMLRPGAERIAKLGGLHSFMGWDRPILTDSGGFQVMSLSSLTKQSEEGVTFKSHLDGSRHMLSPERSIEIQHLLGSDIVMAFDECTPYPATPSRAASSMERSMRWAKRSRDAFDSRKEQAENAA--LFGIQQGSVFENLRQQSADALAEI-GFDGYAVGGLAVGEG---QDEMFRVLDFSVPMLPDDKPHYLMGVGKPDDIVGAVERGIDMFDCVLPTRSGRNGQAFTWDGPINIRNARFSEDLKPLDSECHCAVCQKWSRAYIHHLIRAGEILGAMLMTEHNIAFYQQLMQKIRDSISEGRFSQFAQDFRARYF----