@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : jhp_0840: (2015-12-18 )
MEILVLNLGSSSIKFKLFDMKENKPLASGLAEKIGEEIGQLKIKSHLHHNDQELKEKLVIKDHAIGLLMIRENLTKMGIIKDFNQIDAIGHRVVQGGDKFHAPVLVDEKVMREIGNLSILAPLHNPANLAGIEFVQKAHPHIPQIAVFDTAFHASMPSYAYMYALPYELYEKYQIRRYGFHGTSHHYVAKEAAKFLNIPYEEFNAISLHLGNGSSAAAIQNGKSVDTSMGLTPLEGLIMGTRCGDIDPTVVEYIAQCANKSLEEVMKILNHESGLKGICGDNDARNIEVRKEKGDKQAKLAFEMCVYRIKKYIGAYMVVLKKVDAIIFTGGLGENYSALRESVCEGLENLGIALHKPTNDNPGSALVNLSQPNTKIQILRIPTDEELEIALQAKEMVEKIKVV

Atome Classification :

(33 SA) .........10........20........30........40--....----....50........60........70....--....--80........90........100.......110.......120.......130.......140.--......150.......160.......170.......180.......190.......200.......210.......220.......230.......240.......250.......260.......270.......280.-........290.......300.......310.......320........330.......340.......350.......360---..-.....370.-......380.......390.......400.
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MEILVLNLGSSSIKFKLFDMKENKPLASGLAEKIGEEIGQL--KIKS----HLHHNDQELKEKLVIKDHAIGLLMIRENLT--KMGI--IKDFNQIDAIGHRVVQGGDKFHAPVLVDEKVMREIGNLSILAPLHNPANLAGIEFVQKAHPHIP--QIAVFDTAFHASMPSYAYMYALPYELYEKYQIRRYGFHGTSHHYVAKEAAKFLNIPYEEFNAISLHLGNGSSAAAIQNGKSVDTSMGLTPLEGLIMGTRCGDIDPTVVEYIAQCANKSLEEVMKILNHESGLKGICG--D-NDARNIEVRKEKGDKQAKLAFEMCVYRIKKYIGAYMVVLK-KVDAIIFTGGLGENYSALRESVCEGLENLGIALHKPTNDNP---GS-ALVNLSQPN-TKIQILRIPTDEELEIALQAKEMVEKIKVV
43 Fugue 96.3446% -94 - C5 -1G99 ACKA_METTE A:[1-398] MKVLVINAGSSSLKYQLIDMTNESALAVGLCERIGIDNSII--TQKK----F---DGKKLEKLTDLPTHKDALEEVVKALTDDEFGV--IKDMGEINAVGHRVVHGGEKFTTSALYDEGVEKAIKDCFELAPLHNPPNMMGISACAEIMPGTP--MVIVFDTAFHQTMPPYAYMYALPYDLYEKHGVRKYGFHGTSHKYVAERAALMLGKPAEETKIITCHLGNGSSITAVEGGKSVETSMGFTPLEGLAMGTRCGSIDPAIVPFLMEKEGLTTREIDTLMNKKSGVLGVSGL-S-NDFRDLDEAASKGNRKAELALEIFAYKVKKFIGEYSAVLN-GADAVVFTAGIGENSASIRKRILTGLDGIGIKIDDEKNKIR---GQ-E-IDISTPD-AKVRVFVIPTNEELAIARETKEIVET----
1 PsiBlast_PDB 96.3049%-101 - C5 -2IIR - ACKA_THEMA A:[1-400] MRVLVINSGSSSIKYQLIEMEGEKVLCKGIAERIGIEGSRLVHRVGD----EKHVIERELP------DHEEALKLILNTLVDEKLGV--IKDLKEIDAVGHRVVHGGERFKESVLVDEEVLKAIEEVSPLAPLHNPANLMGIKAAMKLLPGVP--NVAVFDTAFHQTIPQKAYLYAIPYEYYEKYKIRRYGFHGTSHRYVSKRAAEILGKKLEELKIITCHIGNGASVAAVKYGKCVDTSMGFTPLEGLVMGTRSGDLDPAIPFFIMEKEGISPQEMYDILNKKSGVYGLSKGFS-SDMRDIEEAALKGDEWCKLVLEIYDYRIAKYIGAYAAAMN-GVDAIVFTAGVGENSPITREDVCSYLEFLGVKLDKQKNEETIR-GK-EGI-ISTPD-SRVKVLVVPTNEELMIARDTKEIVEK----
53 HHSearch 94.8846% -93 - C5 -1G99 ACKA_METTE A:[1-398] MKVLVINAGSSSLKYQLIDMTNESALAVGLCERIGIDNSII--TQKK----FD---GKKLEKLTDLPTHKDALEEVVKALT--DDEFGVIKDMGEINAVGHRVVHGGEKFTTSALYDEGVEKAIKDCFELAPLHNPPNMMGISACAEIMPGTP--MVIVFDTAFHQTMPPYAYMYALPYDLYEKHGVRKYGFHGTSHKYVAERAALMLGKPAEETKIITCHLGNGSSITAVEGGKSVETSMGFTPLEGLAMGTRCGSIDPAIVPFLMEKEGLTTREIDTLMNKKSGVLGVSG--LSNDFRDLDEAASKGNRKAELALEIFAYKVKKFIGEYSAVLN-GADAVVFTAGIGENSASIRKRILTGLDGIGIKIDDEKNKIR---G--QEIDISTPD-AKVRVFVIPTNEELAIARETKEIVET----
3 PsiBlast_PDB 94.6645% -95 - C5 -1TUY ACKA_METTE A:[1-397] MKVLVINAGSSSLKYQLIDMTNESALAVGLCERIGID---N--SIIT----QKKFDGKKLEKLTDLPTHKDALEEVVKALTDDEFGV--IKDMGEINAVGHRVVHGGEKFTTSALYDEGVEKAIKDCFELAPLHNPPNMMGISACAEIMPGTP--MVIVFDTAFHQTMPPYAYMYALPYDLYEKHGVRKYGFHGTSHKYVAERAALMLGKPAEETKIITCHLGNGSSITAVEGGKSVETSMGFTPLEGLAMGTRCGSIDPAIVPFLMEKEGLTTREIDTLMNKKSGVLGVSGL-S-NDFRDLDEAASKGNRKAELALEIFAYKVKKFIGEYSAVLN-GADAVVFTAGIGENSASIRKRILTGLDGIGIKIDDEKNKIR---GQ-E-IDISTPD-AKVRVFVIPTNEELAIARETKEIVETE---
4 PsiBlast_PDB 94.5745% -91 - C5 -1G99 ACKA_METTE A:[1-397] MKVLVINAGSSSLKYQLIDMTNESALAVGLCERIGID---N--SIIT----QKKFDGKKLEKLTDLPTHKDALEEVVKALTDDEFGV--IKDMGEINAVGHRVVHGGEKFTTSALYDEGVEKAIKDCFELAPLHNPPNMMGISACAEIMPGTP--MVIVFDTAFHQTMPPYAYMYALPYDLYEKHGVRKYGFHGTSHKYVAERAALMLGKPAEETKIITCHLGNGSSITAVEGGKSVETSMGFTPLEGLAMGTRCGSIDPAIVPFLMEKEGLTTREIDTLMNKKSGVLGVSGL-S-NDFRDLDEAASKGNRKAELALEIFAYKVKKFIGEYSAVLN-GADAVVFTAGIGENSASIRKRILTGLDGIGIKIDDEKNKIR---GQ-E-IDISTPD-AKVRVFVIPTNEELAIARETKEIVET----
55 HHSearch 94.5050% -97 * C5 *2IIR - ACKA_THEMA A:[1-400] MRVLVINSGSSSIKYQLIEMEGEKVLCKGIAERIGIEGSRL--VHRV----GD---EKHVI-ERELPDHEEALKLILNTLV--DEKLGVIKDLKEIDAVGHRVVHGGERFKESVLVDEEVLKAIEEVSPLAPLHNPANLMGIKAAMKLLPGVP--NVAVFDTAFHQTIPQKAYLYAIPYEYYEKYKIRRYGFHGTSHRYVSKRAAEILGKKLEELKIITCHIGNGASVAAVKYGKCVDTSMGFTPLEGLVMGTRSGDLDPAIPFFIMEKEGISPQEMYDILNKKSGVYGLSKGFS-SDMRDIEEAALKGDEWCKLVLEIYDYRIAKYIGAYAAAMN-GVDAIVFTAGVGENSPITREDVCSYLEFLGVKLDKQKNEET---IRGKEGIISTPD-SRVKVLVVPTNEELMIARDTKEIVEK----
23 PsiBlast_CBE 93.8945% -94 - C5 -1G99 ACKA_METTE B:[1-397] MKVLVINAGSSSLKYQLIDMTNESALAVGLCERIGID---N--SIIT----QKKFDGKKLEKLTDLPTHKDALEEVVKALTDDEFGV--IKDMGEINAVGHRVVHGGEKFTTSALYDEGVEKAIKDCFELAPLHNPPNMMGISACAEIMPGTP--MVIVFDTAFHQTMPPYAYMYALPYDLYEKHGVRKYGFHGTSHKYVAERAALMLGKPAEETKIITCHLGNGSSITAVEGGKSVETSMGFTPLEGLAMGTRCGSIDPAIVPFLMEKEGLTTREIDTLMNKKSGVLGVSGL-S-NDFRDLDEAASKGNRKAELALEIFAYKVKKFIGEYSAVLN-GADAVVFTAGIGENSASIRKRILTGLDGIGIKIDDEKNKIR---GQ-E-IDISTPD-AKVRVFVIPTNEELAIARETKEIVET----
22 PsiBlast_CBE 93.3045% -94 - C5 -1TUU ACKA_METTE B:[1-397] MKVLVINAGSSSLKYQLIDMTNESALAVGLCERIGID---N--SIIT----QKKFDGKKLEKLTDLPTHKDALEEVVKALTDDEFGV--IKDMGEINAVGHRVVHGGEKFTTSALYDEGVEKAIKDCFELAPLHNPPNMMGISACAEIMPGTP--MVIVFDTAFHQTMPPYAYMYALPYDLYEKHGVRKYGFHGTSHKYVAERAALMLGKPAEETKIITCHLGNGSSITAVEGGKSVETSMGFTPLEGLAMGTRCGSIDPAIVPFLMEKEGLTTREIDTLMNKKSGVLGVSGL-S-NDFRDLDEAASKGNRKAELALEIFAYKVKKFIGEYSAVLN-GADAVVFTAGIGENSASIRKRILTGLDGIGIKIDDEKNKIR---GQ-E-IDISTPD-AKVRVFVIPTNEELAIARETKEIVET----
57 HHSearch 93.1544%-102 - C5 -3R9P ACKA_MYCPA A:[12-390] RRVLVINSGSSSLKFQLVDPEFGVAASTGIVERIGEES-------------------------SPVPDHDAALRRAFDMLA--GDGV--DLNTAGLVAVGHRVVHGGNTFYRPTVLDDAVIARLHELSELAPLHNPPALQGIEVARRLLPDIA--HVAVFDTGFFHDLPPAAATYAIDRELADRWQIRRYGFHGTSHRYVSEQAAAFLDRPLRGLKQIVLHLGNGCSASAIAGTRPLDTSMGLTPLEGLVMGTRSGDIDPSIVSYLCHTAGMGVDDVESMLNHRSGVVGLSG--V-RDFRRLRELIESGDGAAQLAYSVFTHRLRKYIGAYLAVLG-HTDVISFTAGIGENDAAVRRDAVSGMEELGIVLDERRNLAG---GK-GARQISADD-SPITVLVVPTNEELAIARDCVRVLGG----
2 PsiBlast_PDB 93.1145% -88 - C5 -1TUU ACKA_METTE A:[1-397] MKVLVINAGSSSLKYQLIDMTNESALAVGLCERIGID---N--SIIT----QKKFDGKKLEKLTDLPTHKDALEEVVKALTDDEFGV--IKDMGEINAVGHRVVHGGEKFTTSALYDEGVEKAIKDCFELAPLHNPPNMMGISACAEIMPGTP--MVIVFDTAFHQTMPPYAYMYALPYDLYEKHGVRKYGFHGTSHKYVAERAALMLGKPAEETKIITCHLGNGSSITAVEGGKSVETSMGFTPLEGLAMGTRCGSIDPAIVPFLMEKEGLTTREIDTLMNKKSGVLGVSGL-S-NDFRDLDEAASKGNRKAELALEIFAYKVKKFIGEYSAVLN-GADAVVFTAGIGENSASIRKRILTGLDGIGIKIDDEKNKIR---GQ-E-IDISTPD-AKVRVFVIPTNEELAIARETKEIVETE---
21 PsiBlast_CBE 92.7845% -93 - C5 -1TUY ACKA_METTE B:[1-397] MKVLVINAGSSSLKYQLIDMTNESALAVGLCERIGID---N--SIIT----QKKFDGKKLEKLTDLPTHKDALEEVVKALTDDEFGV--IKDMGEINAVGHRVVHGGEKFTTSALYDEGVEKAIKDCFELAPLHNPPNMMGISACAEIMPGTP--MVIVFDTAFHQTMPPYAYMYALPYDLYEKHGVRKYGFHGTSHKYVAERAALMLGKPAEETKIITCHLGNGSSITAVEGGKSVETSMGFTPLEGLAMGTRCGSIDPAIVPFLMEKEGLTTREIDTLMNKKSGVLGVSGL-S-NDFRDLDEAASKGNRKAELALEIFAYKVKKFIGEYSAVLN-GADAVVFTAGIGENSASIRKRILTGLDGIGIKIDDEKNKIR---GQ-E-IDISTPD-AKVRVFVIPTNEELAIARETKEIVET----
8 PsiBlast_PDB 91.7543%-102 - C5 -4IZ9 ACKA_MYCA1 A:[14-383] -RVLVINSGSSSLKFQLVDPESGVAASTGIVERIGE--SP-------------------------VPDHDAALRRAFDMLA--GDGV--DLNTAGLVAVGHRVVHGGNTFYRPTVLDDAVIARLHELSELAPLHNPPALLGIEVARRLLPGIA--HVAVFDTGFFHDLPPAAATYAIDRELADRWQIRRYGFHGTSHRYVSEQAAAFLDRPLRGLKQIVLHLGNGCSASAIAGTRPLDTSMGLTPLEGLVMGTRSGDIDPSVVSYLCHTAGMGVDDVESMLNHRSGVVGLSG--V-RDFRRLRELIESGDGAAQLAYSVFTHRLRKYIGAYLAVLG-HTDVISFTAGIGENDAAVRRDAVSGMEELGIVLDERRNLPG---AK-GARQISADD-SPITVLVVPTNEELAIARDCVRVLGG----
5 PsiBlast_PDB 90.8343%-100 - C5 -3R9P ACKA_MYCPA A:[13-382] -RVLVINSGSSSLKFQLVDPEFGVAASTGIVERIGEESSP-------------------------VPDHDAALRRAFDMLA--GDGV--DLNTAGLVAVGHRVVHGGNTFYRPTVLDDAVIARLHELSELAPLHNPPALQGIEVARRLLPDIA--HVAVFDTGFFHDLPPAAATYAIDRELADRWQIRRYGFHGTSHRYVSEQAAAFLDRPLRGLKQIVLHLGNGCSASAIAGTRPLDTSMGLTPLEGLVMGTRSGDIDPSIVSYLCHTAGMGVDDVESMLNHRSGVVGLSG--V-RDFRRLRELIESGDGAAQLAYSVFTHRLRKYIGAYLAVLG-HTDVISFTAGIGENDAAVRRDAVSGMEELGIVLDERRNLAG---GK-GARQISADD-SPITVLVVPTNEELAIARDCVRVLGG----
9 PsiBlast_PDB 90.7942%-104 - C5 -4DQ8 - ACKA_MYCMM A:[10-378] --VLVLNSGSSSLKFQLVEPDSGMSRATGNIERI--------------------------------PDHDAALRRVFEILA--EDDI--DLQSCGLVAVGHRVVHGGKDFYEPTLLNDAVIGKLDELSPLAPLHNPPAVLCIRVARALLPDVP--HIAVFDTAFFHQLPPAAATYAIDRELADVWKIRRYGFHGTSHEYVSQQAAEFLGKPIGDLNQIVLHLGNGASASAVAGGRPVETSMGLTPLEGLVMGTRSGDLDPGVIGYLWRTAKLGVDEIESMLNHRSGMLGLAG--E-RDFRRLRAMIDDGDPAAELAYDVFIHRLRKYVGAYLAVLG-HTDVVSFTAGIGEHDAAVRRDTLAGMAELGISLDERRNACP---SG-GARRISADD-SPVTVLVIPTNEELAIARHCCSVLV-----
7 PsiBlast_PDB 90.6743%-102 - C5 -3P4I ACKA_MYCA1 A:[14-383] -RVLVINSGSSSLKFQLVDPESGVAASTGIVERI--ESSP-------------------------VPDHDAALRRAFDMLA--GDGV--DLNTAGLVAVGHRVVHGGNTFYRPTVLDDAVIARLHELSELAPLHNPPALLGIEVARRLLPGIA--HVAVFDTGFFHDLPPAAATYAIDRELADRWQIRRYGFHGTSHRYVSEQAAAFLDRPLRGLKQIVLHLGNGCSASAIAGTRPLDTSMGLTPLEGLVMGTRSGDIDPSVVSYLCHTAGMGVDDVESMLNHRSGVVGLSG--V-RDFRRLRELIESGDGAAQLAYSVFTHRLRKYIGAYLAVLG-HTDVISFTAGIGENDAAVRRDAVSGMEELGIVLDERRNLPG---AK-GARQISADD-SPITVLVVPTNEELAIARDCVRVLGG----
6 PsiBlast_PDB 90.6742%-100 - C5 -4IJN ACKA_MYCS2 A:[23-391] VTVLVVNSGSSSLKYAVVRPASGEFLADGIIEEIGSG---------------------------AVPDHDAALRAAFDELA--AAGL--HLEDLDLKAVGHRMVHGGKTFYKPSVVDDELIAKARELSPLAPLHNPPAIKGIEVARKLLPDLP--HIAVFDTAFFHDLPAPASTYAIDRELAETWHIKRYGFHGTSHEYVSQQAAIFLDRPLESLNQIVLHLGNGASASAVAGGKAVDTSMGLTPMEGLVMGTRSGDIDPGVIMYLWRTAGMSVDDIESMLNRRSGVLGLGG--A-SDFRKLRELIESGDEHAKLAYDVYIHRLRKYIGAYMAVLG-RTDVISFTAGVGENVPPVRRDALAGLGGLGIEIDDALNSAK---SD-EPRLISTPD-SRVTVLVVPTNEELAIARACVGV-------
24 PsiBlast_CBE 90.5243%-103 - C5 -3R9P ACKA_MYCPA B:[13-382] -RVLVINSGSSSLKFQLVDPEFGVAASTGIVERIGE--SP-------------------------VPDHDAALRRAFDMLA--GDGV--DLNTAGLVAVGHRVVHGGNTFYRPTVLDDAVIARLHELSELAPLHNPPALQGIEVARRLLPDIA--HVAVFDTGFFHDLPPAAATYAIDRELADRWQIRRYGFHGTSHRYVSEQAAAFLDRPLRGLKQIVLHLGNGCSASAIAGTRPLDTSMGLTPLEGLVMGTRSGDIDPSIVSYLCHTAGMGVDDVESMLNHRSGVVGLSG--V-RDFRRLRELIESGDGAAQLAYSVFTHRLRKYIGAYLAVLG-HTDVISFTAGIGENDAAVRRDAVSGMEELGIVLDERRNLAG---GK-GARQISADD-SPITVLVVPTNEELAIARDCVRVLGG----
25 PsiBlast_CBE 90.3442% -98 - C5 -4IJN ACKA_MYCS2 B:[23-391] VTVLVVNSGSSSLKYAVVRPASGEFLADGIIEEIGSG---------------------------AVPDHDAALRAAFDELA--AAGL--HLEDLDLKAVGHRMVHGGKTFYKPSVVDDELIAKARELSPLAPLHNPPAIKGIEVARKLLPDLP--HIAVFDTAFFHDLPAPASTYAIDRELAETWHIKRYGFHGTSHEYVSQQAAIFLDRPLESLNQIVLHLGNGASASAVAGGKAVDTSMGLTPMEGLVMGTRSGDIDPGVIMYLWRTAGMSVDDIESMLNRRSGVLGLGG--A-SDFRKLRELIESGDEHAKLAYDVYIHRLRKYIGAYMAVLG-RTDVISFTAGVGENVPPVRRDALAGLGGLGIEIDDALNSAK---SD-EPRLISTPD-SRVTVLVVPTNEELAIARACVGV-------
12 PsiBlast_PDB 86.2341% -86 - C5 -3SLC ACKA_SALTY A:[21-414] --VLVLNCGSSSLKFAIIDAVNGDEYLSGLAECF--HLPEA--RIKW----KMDGSKQEAALGAGAAHSEALNFIVNTILA--QKPE--LS--AQLTAIGHRIVHGGEKYTSSVVIDESVIQGIKDSASFAPLHNPAHLIGIAEALKSFPQLKDKNVAVFDTAFHQTMPEESYLYALPYSLYKEHGVRRYGAHGTSHFYVTQEAAKMLNKPVEELNIITCHLGNGGSVSAIRNGKCVDTSMGLTPLEGLVMGTRSGDIDPAIIFHLHDTLGMSVDQINKMLTKESGLLGLTEV-T-SDCRYVE-DNYATKEDAKRAMDVYCHRLAKYIGSYTALMDGRLDAVVFTGGIGENAAMVRELSLGKLGVLGFEVDHERNLAARFGKS-GFIN--KEG-TRPAVV-IPTNEELVIAQDASRLTA-----
27 PsiBlast_CBE 86.0741% -84 - C5 -3SLC ACKA_SALTY B:[21-414] --VLVLNCGSSSLKFAIIDAVNGDEYLSGLAECF--HLPEA--RIKW----KMDGSKQEAALGAGAAHSEALNFIVNTILA--QKPE--LS--AQLTAIGHRIVHGGEKYTSSVVIDESVIQGIKDSASFAPLHNPAHLIGIAEALKSFPQLKDKNVAVFDTAFHQTMPEESYLYALPYSLYKEHGVRRYGAHGTSHFYVTQEAAKMLNKPVEELNIITCHLGNGGSVSAIRNGKCVDTSMGLTPLEGLVMGTRSGDIDPAIIFHLHDTLGMSVDQINKMLTKESGLLGLTEV-T-SDCRYVE-DNYATKEDAKRAMDVYCHRLAKYIGSYTALMDGRLDAVVFTGGIGENAAMVRELSLGKLGVLGFEVDHERNLAARFGKS-GFIN--KEG-TRPAVV-IPTNEELVIAQDASRLTA-----
20 PsiBlast_PDB 83.1339% -89 - C5 -4FWK TDCD_SALTY A:[20-402] --VLVINCGSSSIKFSVLDVATCDVLMAGIADGMNTENAFL--SINGDKPINLAHSNYEDALK------AIAFELEKRDLT------------DSVALIGHRIAHGGELFTQSVIITDEIIDNIRRVSPLAPLHNYANLSGIDAARHLFPAVR--QVAVFDTSFHQTLAPEAYLYGLPWEYFSSLGVRRYGFHGTSHRYVSRRAYELLDLDEKDSGLIVAHLGNGASICAVRNGQSVDTSMGMTPLEGLMMGTRSGDVDFGAMAWIAKETGQTLSDLERVVNKESGLLGISGL-S-SDLRVLEKAWHEGHERARLAIKTFVHRIARHIAGHAASLH-RLDGIIFTGGIGENSVLIRQLVIEHLGVLGLTLDVEMNKQP---NS-HGERIISANPSQVICAVIPTNEEKMIALDAIHLGNVKA--
16 PsiBlast_PDB 83.0539% -88 - C5 -1X3N TDCD_SALTY A:[20-402] --VLVINCGSSSIKFSVLDVATCDVLMAGIADGMNTENAFL--SINGDKPINLAHSNYEDALK------AIAFELEKRDLT------------DSVALIGHRIAHGGELFTQSVIITDEIIDNIRRVSPLAPLHNYANLSGIDAARHLFPAVR--QVAVFDTSFHQTLAPEAYLYGLPWEYFSSLGVRRYGFHGTSHRYVSRRAYELLDLDEKDSGLIVAHLGNGASICAVRNGQSVDTSMGMTPLEGLMMGTRSGDVDFGAMAWIAKETGQTLSDLERVVNKESGLLGISGL-S-SDLRVLEKAWHEGHERARLAIKTFVHRIARHIAGHAASLH-RLDGIIFTGGIGENSVLIRQLVIEHLGVLGLTLDVEMNKQP---NS-HGERIISANPSQVICAVIPTNEEKMIALDAIHLGNVKA--
13 PsiBlast_PDB 82.4639% -86 - C5 -4FWL TDCD_SALTY A:[20-402] --VLVINCGSSSIKFSVLDVATCDVLMAGIADGMNTENAFL--SINGDKPIN---SNYEDALK------AIAFELEKRDLT------------DSVALIGHRIAHGGELFTQSVIITDEIIDNIRRVSPLAPLHNYANLSGIDAARHLFPAVR--QVAVFDTSFHQTLAPEAYLYGLPWEYFSSLGVRRYGFHGTSHRYVSRRAYELLDLDEKDSGLIVAHLGNGASICAVRNGQSVDTSMGMTPLEGLMMGTRSGDVDFGAMAWIAKETGQTLSDLERVVNKESGLLGISGL-S-SDLRVLEKAWHEGHERARLAIKTFVHRIARHIAGHAASLH-RLDGIIFTGGIGENSVLIRQLVIEHLGVLGLTLDVEMNKQP---NS-HGERIISANPSQVICAVIPTNEEKMIALDAIHLGNVKA--
18 PsiBlast_PDB 82.3939% -88 - C5 -2E1Z TDCD_SALTY A:[20-402] --VLVINCGSSSIKFSVLDVATCDVLMAGIADGMNTENAFL--SINGDKPINLAHSNYEDALK------AIAFELEKRDLT------------DSVALIGHRIAHGGELFTQSVIITDEIIDNIRRVSPLAPLHNYANLSGIDAARHLFPAVR--QVAVFDTSFHQTLAPEAYLYGLPWEYFSSLGVRRYGFHGTSHRYVSRRAYELLDLDEKDSGLIVAHLGNGASICAVRNGQSVDTSMGMTPLEGLMMGTRSGDVDFGAMAWIAKETGQTLSDLERVVNKESGLLGISGL-S-SDLRVLEKAWHEGHERARLAIKTFVHRIARHIAGHAASLH-RLDGIIFTGGIGENSVLIRQLVIEHLGVLGLTLDVEMNKQP---NS-HGERIISANPSQVICAVIPTNEEKMIALDAIHLGNVKA--
32 PsiBlast_CBE 82.3239% -89 - C5 -4FWP TDCD_SALTY A:[20-402] --VLVINCGSSSIKFSVLDVATCDVLMAGIADGMNTENAFL--SINGDKPINLAHSNYEDALK------AIAFELEKRDLT------------DSVALIGHRIAHGGELFTQSVIITDEIIDNIRRVSPLAPLHNYANLSGIDAARHLFPAVR--QVAVFDTSFHQTLAPEAYLYGLPWEYFSSLGVRRYGFHGTSHRYVSRRAYELLDLDEKDSGLIVAHLGNGASICAVRNGQSVDTSMGMTPLEGLMMGTRSGDVDFGAMAWIAKETGQTLSDLERVVNKESGLLGISGL-S-SDLRVLEKAWHEGHERARLAIKTFVHRIARHIAGHAASLH-RLDGIIFTGGIGENSVLIRQLVIEHLGVLGLTLDVEMNKQP---NS-HGERIISANPSQVICAVIPTNEEKMIALDAIHLGNVKA--
15 PsiBlast_PDB 82.3239% -87 - C5 -1X3M TDCD_SALTY A:[20-402] --VLVINCGSSSIKFSVLDVATCDVLMAGIADGMNTENAFL--SINGDKPINLAHSNYEDALK------AIAFELEKRDLT------------DSVALIGHRIAHGGELFTQSVIITDEIIDNIRRVSPLAPLHNYANLSGIDAARHLFPAVR--QVAVFDTSFHQTLAPEAYLYGLPWEYFSSLGVRRYGFHGTSHRYVSRRAYELLDLDEKDSGLIVAHLGNGASICAVRNGQSVDTSMGMTPLEGLMMGTRSGDVDFGAMAWIAKETGQTLSDLERVVNKESGLLGISGL-S-SDLRVLEKAWHEGHERARLAIKTFVHRIARHIAGHAASLH-RLDGIIFTGGIGENSVLIRQLVIEHLGVLGLTLDVEMNKQP---NS-HGERIISANPSQVICAVIPTNEEKMIALDAIHLGNVKA--
19 PsiBlast_PDB 82.2839% -89 - C5 -2E20 TDCD_SALTY A:[20-402] --VLVINCGSSSIKFSVLDVATCDVLMAGIADGMNTENAFL--SINGDKPINLAHSNYEDALK------AIAFELEKRDLT------------DSVALIGHRIAHGGELFTQSVIITDEIIDNIRRVSPLAPLHNYANLSGIDAARHLFPAVR--QVAVFDTSFHQTLAPEAYLYGLPWEYFSSLGVRRYGFHGTSHRYVSRRAYELLDLDEKDSGLIVAHLGNGASICAVRNGQSVDTSMGMTPLEGLMMGTRSGDVDFGAMAWIAKETGQTLSDLERVVNKESGLLGISGL-S-SDLRVLEKAWHEGHERARLAIKTFVHRIARHIAGHAASLH-RLDGIIFTGGIGENSVLIRQLVIEHLGVLGLTLDVEMNKQP---NS-HGERIISANPSQVICAVIPTNEEKMIALDAIHLGNVKA--
29 PsiBlast_CBE 82.1639% -85 - C5 -4FWS TDCD_SALTY A:[20-402] --VLVINCGSSSIKFSVLDVATCDVLMAGIADGMNTENAFL--SINGDKPINLAHSNYEDALK------AIAFELEKRDLT------------DSVALIGHRIAHGGELFTQSVIITDEIIDNIRRVSPLAPLHNYANLSGIDAARHLFPAVR--QVAVFDTSFHQTLAPEAYLYGLPWEYFSSLGVRRYGFHGTSHRYVSRRAYELLDLDEKDSGLIVAHLGNGASICAVRNGQSVDTSMGMTPLEGLMMGTRSGDVDFGAMAWIAKETGQTLSDLERVVNKESGLLGISGL-S-SDLRVLEKAWHEGHERARLAIKTFVHRIARHIAGHAASLH-RLDGIIFTGGIGENSVLIRQLVIEHLGVLGLTLDVEMNKQP---NS-HGERIISANPSQVICAVIPTNEEKMIALDAIHLGNVKA--