@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : jhp_1142: (2015-12-21 )
MDSTLKHLAIIMDGNGRWAKLKNKARAYGHKKGVKTLKDITIWCANHKLECLTLYAFSTENWKRPKSEVDFLMKMLKKYLKDERSTYLDNNIRFRAIGDLEGFSKELRDTILRLENDTRYFKDFTQVLALNYGSKNELSRAFKSLLENPPNHINNIESLENEISHRLDTHDLPEVDLLLRTGGEMRLSNFLLWQSSYAELFFTPILWPDFTPKDLENIISDFYKRVRKFGELKC

Atome Classification :

(51 SA) .........10.-.......20........30........40........50.......-.60........70........80........90........100.......110.......120.......130.......140....-..------.150........-160-.......-170.----......180.......190.......200.......210.......220.......230..
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MDSTLKHLAIIM-DGNGRWAKLKNKARAYGHKKGVKTLKDITIWCANHKLECLTLYAFS-TENWKRPKSEVDFLMKMLKKYLKDERSTYLDNNIRFRAIGDLEGFSKELRDTILRLENDTRYFKDFTQVLALNYGSKNELSRAFKSLL-EN------PPN-HINNIESL-ENE-ISHRLDT-HDLP----EVDLLLRTGGEMRLSNFLLWQSSYAELFFTPILWPDFTPKDLENIISDFYKRVRKFGELKC
2 PsiBlast_PDB 97.5294%-109 - C8 -2DTN - ISPT_HELPY A:[14-237] --STLKHLAIIM-DGNGRWAKLKNKARAYGHKKGVKTLKDITIWCANHKLECLTLYAF-----------EVDFLMKMLKKYLKDERSTYLDNNIRFRAIGDLEGFSKELRDTILQLENDTRHFKDFTQVLALNYGSKNELSRAFKSLL-ES------PPS-NISLLESL-ENE-ISNRLDT-RNLP----EVDLLLRTGGEMRLSNFLLWQSSYAELFFTPILWPDFTPKDLENIISDFYKRV--------
21 PsiBlast_CBE 96.8894%-107 - C8 -2DTN ISPT_HELPY B:[15-242] ---TLKHLAIIM-DGNGRWAKLKNKARAYGHKKGVKTLKDITIWCANHKLECLTLYA-----------------MKMLKKYLKDERSTYLDNNIRFRAIGDLEGFSKELRDTILQLENDTRHFKDFTQVLALNYGSKNELSRAFKSLL-ES------P----------L-ENE-ISNRLDT-RNLP----EVDLLLRTGGEMRLSNFLLWQSSYAELFFTPILWPDFTPKDLENIISDFYKRVRKFGE---
1 PsiBlast_PDB 96.5194%-110 - C8 -2D2R - ISPT_HELPY A:[3-227] --STLKHLAIIM-DGNGRWAKLKNKARAYGHKKGVKTLKDITIWCANHKLECLTLYAF-----------EVDFLMKMLKKYLKDERSTYLDNNIRFRAIGDLEGFSKELRDTILQLENDTRHFKDFTQVLALNYGSKNELSRAFKSLL-ES------PPS-NISLLESL-ENE-ISNRLDT-RNLP----EVDLLLRTGGEMRLSNFLLWQSSYAELFFTPILWPDFTPKDLENIISDFYKRVR-------
85 HHSearch 95.5094%-106 - C8 -2D2R - ISPT_HELPY A:[3-227] --STLKHLAIIM-DGNGRWAKLKNKARAYGHKKGVKTLKDITIWCANHKLECLTLYAF-----------EVDFLMKMLKKYLKDERSTYLDNNIRFRAIGDLEGFSKELRDTILQLENDTRHFKDFTQVLALNYGSKNELSRAFKSLL-ES------PPS-N-ISLLESLENE-ISNRLDT-RNLP----EVDLLLRTGGEMRLSNFLLWQSSYAELFFTPILWPDFTPKDLENIISDFYKRVR-------
4 PsiBlast_PDB 84.1142% -92 - C8 -1V7U UPPS_ECOLI A:[19-239] -----RHVAIIM-DGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFS-SENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLA-EKVQQGNLQPD-QID------EEM-LNQHVCM-HELA----PVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANR---------
43 PsiBlast_CBE 83.8042% -93 - C8 -1X08 UPPS_ECOLI A:[19-240] -----RHVAIIM-AGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFS-SENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLA-EKVQQGNLQPD-QID------EEM-LNQHVCM-HELA----PVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE--------
34 PsiBlast_CBE 83.6642% -96 - C8 -2E9D UPPS_ECOLI B:[19-243] -----RHVAIIM-DGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFS-S----------SALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLA-EKVQQGNLQPD-QID------EEM-LNQHVCM-HELA----PVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRERRF-----
40 PsiBlast_CBE 83.3342% -93 - C8 -1UEH UPPS_ECOLI B:[19-241] -----RHVAIIM-DGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFS-SENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLA-EKVQQGNLQPD-QID------EEM-LNQHVCM-HELA----PVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRER-------
49 PsiBlast_CBE 83.2539% -84 - C8 -4H8E ISPT_STAAN A:[26-253] -----EHIAIIM-DGNGRWAKKRKMPRIKGHYEGMQTIKKITRIASDIGVKYLTLYAFS-TENWSRPESEVNYIMNLPVNFLKTFLPELIEKNVKVETIGFTDKLPKSTIEAINNAKEKTANNTGLKLIFAINYGGRAELVHSIKNMF-DE------LHQ-QGLNSDIIDETY-INNHLMT-KDYP----DPELLIRTSGEQRISNFLIWQVSYSEFIFNQKLWPDFDEDELIKCIKIYQSRQRRFGGL--
48 PsiBlast_CBE 83.0239% -82 - C8 -4U82 ISPT_STAAN A:[26-253] -----EHIAIIM-DGNGRWAKKRKMPRIKGHYEGMQTIKKITRIASDIGVKYLTLYAFS-TENWSRPESEVNYIMNLPVNFLKTFLPELIEKNVKVETIGFTDKLPKSTIEAINNAKEKTANNTGLKLIFAINYGGRAELVHSIKNMF-DE------LHQ-QGLNSDIIDETY-INNHLMT-KDYP----DPELLIRTSGEQRISNFLIWQVSYSEFIFNQKLWPDFDEDELIKCIKIYQSRQRRFGGLS-
38 PsiBlast_CBE 83.0242%-100 - C8 -2E98 UPPS_ECOLI B:[19-243] -----RHVAIIM-DGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFS-S----------SALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLA-EKVQQGNLQPD-QID------EEM-LNQHVCM-HELA----PVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRERRF-----
39 PsiBlast_CBE 82.9842% -99 - C8 -1V7U UPPS_ECOLI B:[19-240] -----RHVAIIM-DGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFS-SE----PAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLA-EKVQQGNLQPD-QID------EEM-LNQHVCM-HELA----PVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE--------
55 PsiBlast_CBE 82.9437% -84 - C8 -4ONC DPDS_MYCTU B:[53-282] -DRLPNHVAIVM-DGNGRWATQRGLARTEGHKMGEAVVIDIACGAIELGIKWLSLYAFS-TENWKRSPEEVRFLMGFNRDVVRRRRDTLKKLGVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEATREIAREV------AAG-RLNPERIT-EST-IARHLQR-PDIP----DVDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGSA--
37 PsiBlast_CBE 82.8842%-101 - C8 -2E99 UPPS_ECOLI B:[19-243] -----RHVAIIM-DGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFS-S----------SALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLA-EKVQQGNLQPD-QID------EEM-LNQHVCM-HELA----PVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRERRF-----
17 PsiBlast_PDB 82.8042%-101 - C8 -3SH0 UPPS_ECOLI B:[19-240] -----RHVAIIM-DGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFS-S------AQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLA-EKVQQGNLQPD-QID------EEM-LNQHVCM-HELA----PVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE--------
5 PsiBlast_PDB 82.5742% -91 - C8 -1X06 UPPS_ECOLI A:[19-240] -----RHVAIIM-DGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFS-SENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLA-EKVQQGNLQPD-QID------EEM-LNQHVCM-HELA----PVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE--------
42 PsiBlast_CBE 82.5042% -92 - C8 -1X09 UPPS_ECOLI A:[19-239] -----RHVAIIM-AGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFS-SENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLA-EKVQQGNLQPD-QID------EEM-LNQHVCM-HELA----PVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANR---------
36 PsiBlast_CBE 82.4442% -99 - C8 -2E9A UPPS_ECOLI B:[19-242] -----RHVAIIM-DGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFS-------------ALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLA-EKVQQGNLQPD-QID------EEM-LNQHVCM-HELA----PVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRERR------
30 PsiBlast_CBE 82.3142% -97 - C8 -3WYJ UPPS_ECOLI A:[19-240] -----RHVAIIM-DGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFS-S-----PAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLA-EKVQQGNLQPD-QID------EEM-LNQHVCM-HELA----PVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE--------
6 PsiBlast_PDB 82.1442% -95 - C8 -1X07 UPPS_ECOLI A:[19-240] -----RHVAIIM-DGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFS-SENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLA-EKVQQGNLQPD-QID------EEM-LNQHVCM-HELA----PVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE--------
81 HHSearch 82.0542% -94 * C8 *3SGV UPPS_ECOLI B:[15-240] -AHGCRHVAIIM-DGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAF------------VSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLA-EK------VQQ-GNLQPDQIDEEM-LNQHVCM-HELA----PVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE--------
64 PsiBlast_CBE 81.8937% -80 - C8 -2VG2 DPDS_MYCTU A:[53-282] -DRLPNHVAIVM-DGNGRWATQRGLARTEGHKMGEAVVIDIACGAIELGIKWLSLYAFS-TENWKRSPEEVRFLMGFNRDVVRRRRDTLKKLGVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEATREIAREV------AAG-RLNPERIT-EST-IARHLQR-PDIP----DVDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGSA--
14 PsiBlast_PDB 81.7542% -95 - C8 -3SGT UPPS_ECOL6 B:[19-240] -----RHVAIIM-DGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFS-SEN---PAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLA-EKVQQGNLQPD-QID------EEM-LNQHVCM-HELA----PVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE--------
33 PsiBlast_CBE 81.5942% -95 - C8 -3SGV UPPS_ECOLI A:[19-238] -----RHVAIIM-DGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFS-SENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLA-EKVQQGNLQPD-QID------EEM-LNQHVCM-HELA----PVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFAN----------
56 PsiBlast_CBE 81.5637% -83 - C8 -4ONC DPDS_MYCTU A:[53-280] -DRLPNHVAIVM-DGNGRWATQRGLARTEGHKMGEAVVIDIACGAIELGIKWLSLYAFS-TENWKRSPEEVRFLMGFNRDVVRRRRDTLKKLGVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEATREIAREV------AAG-RLNPERIT-EST-IARHLQR-PDIP----DVDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRR------
62 PsiBlast_CBE 81.5337% -84 - C8 -2VG2 DPDS_MYCTU C:[53-282] -DRLPNHVAIVM-DGNGRWATQRGLARTEGHKMGEAVVIDIACGAIELGIKWLSLYAFS-TENWKRSPEEVRFLMGFNRDVVRRRRDTLKKLGVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEATREIAREV------AAG-RLNPERIT-EST-IARHLQR-PDIP----DVDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGSA--
35 PsiBlast_CBE 81.4842% -93 - C8 -2E9C UPPS_ECOLI B:[19-239] -----RHVAIIM-DGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFS-S----------SALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLA-EKVQQGNLQPD-QID------EEM-LNQHVCM-HELA----PVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANR---------
61 PsiBlast_CBE 81.3237% -84 - C8 -2VG2 DPDS_MYCTU D:[53-282] -DRLPNHVAIVM-DGNGRWATQRGLARTEGHKMGEAVVIDIACGAIELGIKWLSLYAFS-TENWKRSPEEVRFLMGFNRDVVRRRRDTLKKLGVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEATREIAREV------AAG-RLNPERIT-EST-IARHLQR-PDIP----DVDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGSA--
58 PsiBlast_CBE 81.1637% -83 - C8 -2VG3 DPDS_MYCTU C:[53-282] -DRLPNHVAIVM-DGNGRWATQRGLARTEGHKMGEAVVIDIACGAIELGIKWLSLYAFS-TENWKRSPEEVRFLMGFNRDVVRRRRDTLKKLGVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEATREIAREV------AAG-RLNPERIT-EST-IARHLQR-PDIP----DVDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGSA--
44 PsiBlast_CBE 81.1641%-108 - C8 -3UGS ISPT_CAMJE B:[7-224] ----LKHLAVVM-DGNR--------------SQGVKTMQKLMEVCMEENISNLSLFAFS-TENWKRPKDEIDFIFELLDRCLDEALEKFEKNNVRLRAIGDLSRLEDKVREKITLVEEKTKHCDALCVNLAISYGARDEIIRAAKRVI-EK------K-------LELN-EEN-LTQNL----DLPL---DVDLMLRVGNAKRLSNFLLWQCSYAEIYFSETLFPSLTKREFKRIIKEFRNRERTFGK---
15 PsiBlast_PDB 81.0142%-100 - C8 -3SGV UPPS_ECOLI B:[19-240] -----RHVAIIM-DGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAF------------VSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLA-EKVQQGNLQPD-QID------EEM-LNQHVCM-HELA----PVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE--------
60 PsiBlast_CBE 80.8737% -81 - C8 -2VG3 DPDS_MYCTU A:[53-282] -DRLPNHVAIVM-DGNGRWATQRGLARTEGHKMGEAVVIDIACGAIELGIKWLSLYAFS-TENWKRSPEEVRFLMGFNRDVVRRRRDTLKKLGVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEATREIAREV------AAG-RLNPERIT-EST-IARHLQR-PDIP----DVDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGSA--
8 PsiBlast_PDB 80.8042% -87 - C8 -2E99 UPPS_ECOLI A:[19-240] -----RHVAIIM-DGNGRWAKKQGKIRAFGHKAGAKSVRRAVSFAANNGIEALTLYAFS-SENWNRPAQEVSALMELFVWALDSEVKSLHRHNVRLRIIGDTSRFNSRLQERIRKSEALTAGNTGLTLNIAANYGGRWDIVQGVRQLA-EKVQQGNLQPD-QID------EEM-LNQHVCM-HELA----PVDLVIRTGGEHRISNFLLWQIAYAELYFTDVLWPDFDEQDFEGALNAFANRE--------
57 PsiBlast_CBE 80.7837% -85 - C8 -2VG3 DPDS_MYCTU D:[53-282] -DRLPNHVAIVM-DGNGRWATQRGLARTEGHKMGEAVVIDIACGAIELGIKWLSLYAFS-TENWKRSPEEVRFLMGFNRDVVRRRRDTLKKLGVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEATREIAREV------AAG-RLNPERIT-EST-IARHLQR-PDIP----DVDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGSA--
84 HHSearch 80.7342%-100 - C8 -3UGS ISPT_CAMJE B:[4-225] -MNELKHLAVVM-DGNR--------------SQGVKTMQKLMEVCMEENISNLSLFAFS-TENWKRPKDEIDFIFELLDRCLDEALEKFEKNNVRLRAIGDLSRLEDKVREKITLVEEKTKHCDALCVNLAISYGARDEIIRAAKRVI-EK------K--------LELNEEN-LTQNLDL---PL----DVDLMLRVGNAKRLSNFLLWQCSYAEIYFSETLFPSLTKREFKRIIKEFRNRERTFGK---
63 PsiBlast_CBE 80.5937% -81 - C8 -2VG2 DPDS_MYCTU B:[53-282] -DRLPNHVAIVM-DGNGRWATQRGLARTEGHKMGEAVVIDIACGAIELGIKWLSLYAFS-TENWKRSPEEVRFLMGFNRDVVRRRRDTLKKLGVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEATREIAREV------AAG-RLNPERIT-EST-IARHLQR-PDIP----DVDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGS---
59 PsiBlast_CBE 80.5337% -81 - C8 -2VG3 DPDS_MYCTU B:[53-282] -DRLPNHVAIVM-DGNGRWATQRGLARTEGHKMGEAVVIDIACGAIELGIKWLSLYAFS-TENWKRSPEEVRFLMGFNRDVVRRRRDTLKKLGVRIRWVGSRPRLWRSVINELAVAEEMTKSNDVITINYCVNYGGRTEITEATREIAREV------AAG-RLNPERIT-EST-IARHLQR-PDIP----DVDLFLRTSGEQRSSNFMLWQAAYAEYIFQDKLWPDYDRRDLWAACEEYASRTRRFGSA--
45 PsiBlast_CBE 80.5241%-114 - C8 -3UGS ISPT_CAMJE A:[7-224] ----LKHLAVVM-DGNR----------------GVKTMQKLMEVCMEENISNLSLFAFS-TENWKRPKDEIDFIFELLDRCLDEALEKFEKNNV