@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : jhp_1153: (2015-12-21 )
MIVKRLNPDALKSALQKIGPEKIAQTHMRQKGVSFVFEIQHLPLSAALILKQEAISVGGDFATPRDCILAKEPFYDGVLIASAKQLERLIVKCHSQPFGLKHLAQELKSHLKAKKPNAPQIMAILNLTPDSFYEKSRFDSKKALEEIYQWLEKGITLIDIGAASSRPQSEIIDPKVEQDRLKEILLEIKSQKLYQRAQFSIDTYHATTAQMALEHYFSILNDVSGFNSIEMLEVARDYQPTCILMHAQKTPKDMQENVFYHNLFDEMDRFFKEKLEVLEKYTLQDIILDIGFGFAKLKEHNLALIKHLSHFLKFKKPLLVGASRKNTIGLITGREVQDRLAGTLSLHLMALQNGASILRAHDIDEHIDLIKVFKSLEETD

Atome Classification :

(51 SA) .........10........20........30........40........50........60........70........80........90........100.......110.......120.......130.......140-........150-----.......160.......170.......180.......190.--...--...200.......210.......220......-.230...-...-.-240......-.250.-......260----------------------------.......270....--...280.--.--.--....290.......300.......310.----------------......320.......330..------.-....340.......350.......360.......370.......380
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MIVKRLNPDALKSALQKIGPEKIAQTHMRQKGVSFVFEIQHLPLSAALILKQEAISVGGDFATPRDCILAKEPFYDGVLIASAKQLERLIVKCHSQPFGLKHLAQELKSHLKAKKPNAPQIMAILNLTPDSFYEKSRFDS-K-KALEEIYQWLE-----KGITLIDIGAASSRPQSEIIDPKVEQDRLKEILLEIKSQKL--YQR--AQFSIDTYHATTAQMALEHYFSILNDVSGFNS-IEMLEVA-RDY-Q-PTCILMHAQ-KTPKD-MQENVFYHN----------------------------LFDEMDRFFKEKLE--VLEKYTL--Q--D--IILDIGFGFAKLKEHNLALIKHLSHFLK----------------FKKPLLVGASRKNTIGLITGR------E-VQDRLAGTLSLHLMALQNGASILRAHDIDEHIDLIKVFKSLEETD
61 HHSearch 90.5232%-106 - C4 -2DQW - ? A:[26-287] -------------------------------------------------------------------------------------------------------------------LDRVRLLGVLNLTP--------------RALERAREMVA-----EGADILDLGAE-----------EEEKRRLLPVLEAVLSL------G--VPVSVDTRKPEVAEEALKLGAHLLNDVTGLRD-ERMVALA-ARH-G-VAAVVMHMPVPDPAT-MMAHARYRD----------------------------VVAEVKAFLEAQAR--RALSAGV--P--Q--VVLDPGFGFGKLLEHNLALLRRLDEIVA----------------LGHPVLVGLSRKRTIGELSGVE-----D-PAQRVHGSVAAHLFAVMKGVRLLRVHDVRAHREALGVWEALYG--
21 PsiBlast_CBE 90.0932%-115 - C4 -2DZB ? B:[30-286] -----------------------------------------------------------------------------------------------------------------------RLLGVLNLTPD---------P-E-RALERAREMVA-----EGADILDLGAEST-------PVEEEKRRLLPVLEAVLSLGV--------PVSVDTRKPEVAEEALKLGAHLLNDVTGLRD-ERMVALA-ARH-G-VAAVVMHMP---------AHARYRD----------------------------VVAEVKAFLEAQAR--RALSAGV--P--Q--VVLDPGFGFGKLLEHNLALLRRLDEIVA----------------LGHPVLVGLSRKRTIGELSGV------EDPAQRVHGSVAAHLFAVMKGVRLLRVHDVRAHREALGVWEALY---
62 HHSearch 88.8928% -83 - C4 -2BMB FOL1_YEAST A:[222-543] -------------------------------------------------------------------------------------------------------------------VSPTYIMAIFNATPDSFSDGGEHFADIESQLNDIIKLCKDALYLHESVIIDVGGCSTRPNSIQASEEEEIRRSIPLIKAIRESTELPQDK--VILSIDTYRSNVAKEAIKVGVDIINDISGGLFDSNMFAVI-AENPE-ICYILSHTR-GDIST-MNRLAHYENFALGDSIQQEFVHNTDIQQLDDLKDKTVLIRNVGQEIGERYI--KAIDNGV--KRWQ--ILIDPGLGFAKTWKQNLQIIRHIPILKNYSFTMNSNNSQVYVNLRNMPVLLGPSRKKFIGHITKDV-----D-AKQRDFATGAVVASCIGFGSDMVRVHDVKNCSKSIKLADAIYKGL
6 PsiBlast_PDB 88.2633% -89 - C4 -1AJZ DHPS_ECOLI A:[15-271] ----------------------------------------------------------------------------------------------------------------------PHVMGILNVTPDSFSDGGTHNS-LIDAVKHANLMIN-----AGATIIDVGGESTRPGAAEVSVEEELQRVIPVV-EAIAQRF----E--VWISVDTSKPEVIRESAKVGAHIINDIRSLSE-PGALEAA-AET-GLPVC-LMHMQ-GNPKT-MQEAPKYDD----------------------------VFAEVNRYFIEQIA--RCEQAGIAKE--K--LLLDPGFGFGKNLSHNYSLLARLAEFHH----------------FNLPLLVGMSRKSMIGQLLNV------G-PSERLSGSLACAVIAAMQGAHIIRVHDVKETVEAMRVVEATLSAK
5 PsiBlast_PDB 87.0133% -90 - C4 -1AJ2 DHPS_ECOLI A:[15-271] ----------------------------------------------------------------------------------------------------------------------PHVMGILNVTPDSFSDGGTHNS-LIDAVKHANLMIN-----AGATIIDVGGESTRPGAAEVSVEEELQRVIPVV-EAIAQRF----E--VWISVDTSKPEVIRESAKVGAHIINDIRSLSE-PGALEAA-AET-GLPVC-LMHMQ-GNPKT-MQEAPKYDD----------------------------VFAEVNRYFIEQIA--RCEQAGIAKE--K--LLLDPGFGFGKNLSHNYSLLARLAEFHH----------------FNLPLLVGMSRKSMIGQLLNV------G-PSERLSGSLACAVIAAMQGAHIIRVHDVKETVEAMRVVEATLSAK
39 PsiBlast_CBE 86.0231%-108 - C4 -3TYE ? A:[42-291] ------------------------------------------------------------------------------------------------------------------------IMGILNVTP------GSYNEVD-AAVRHAKEMRD-----EGAHIIDIGGESTRPGFAKV--SVEEE-IKRVVPMIQAVSK--EVK--LPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVA-AHY-D-VPIILMHNR---------DNMNYRN----------------------------LMADMIADLYDSIK--IAKDAGV--R--DENIILDPGIGFAKTPEQNLEAMRNLEQLNV----------------LGYPVLLGTSRKSFIGHVLDL------P-VEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK-
66 HHSearch 85.7332% -90 - C4 -1AJ0 DHPS_ECOLI A:[13-274] --------------------------------------------------------------------------------------------------------------------SHPHVMGILNVTPDSFSDGGTHNS-LIDAVKHANLMIN-----AGATIIDVGGESTRPGAAEVSVEEELQRVIPVVEAIAQRF-----E--VWISVDTSKPEVIRESAKVGAHIINDIRSLSE-PGALEAA-AET-G-LPVCLMHMQ-GNPKT-MQEAPKYDD----------------------------VFAEVNRYFIEQIA--RCEQAGI--AKEK--LLLDPGFGFGKNLSHNYSLLARLAEFHH----------------FNLPLLVGMSRKSMIGQLLNV------G-PSERLSGSLACAVIAAMQGAHIIRVHDVKETVEAMRVVEATLSAK
40 PsiBlast_CBE 85.7231%-113 - C4 -3TYD ? B:[42-291] ------------------------------------------------------------------------------------------------------------------------IMGILNVTPD----GGSYNEVD-AAVRHAKEMRD-----EGAHIIDIGGEST---------SVEEE-IKRVVPMIQAVSK--EVK--LPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVA-AHY-D-VPIILMHNR---------DNMNYRN----------------------------LMADMIADLYDSIK--IAKDAGV--R--DENIILDPGIGFAKTPEQNLEAMRNLEQLNV----------------LGYPVLLGTSRKSFIGHVLDL------P-VEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK-
1 PsiBlast_PDB 85.7034% -95 - C4 -3TYU ? A:[18-274] ----------------------------------------------------------------------------------------------------------------------PQVMGILNVTPDS------HNNLD-QALQHAQRMLS-----AGATLIDIGGESTRPGAAEVSEQEELDRVVPVV-----EAL--AQRFDVWLSVDTSKAAVITESAHAGAHLINDIRSLQE-PGALEAAAKTG-L-PVC-LMHMQ-G-----MQHSPYYDD----------------------------LMTDINRFFQHHIERCVAAGIAK--N--K--LLLDPGFGFGKNLAHNYQLLAHLSELHH----------------FELPLLVGMSRKSMVGQLLNV------P-PQQRVIGSVACAVIAAMQGAQIIRVHDVKETVEAMCIVEATRSA-
3 PsiBlast_PDB 85.5734% -89 - C4 -3TZF ? A:[18-274] ----------------------------------------------------------------------------------------------------------------------PQVMGILNVTPDSFSDGGCHNNLD-QALQHAQRMLS-----AGATLIDIGGESTRPGAAEVSEQEELDRVVPVV-----EAL--AQRFDVWLSVDTSKAAVITESAHAGAHLINDIRSLQE-PGALEAAAKTG-L-PVC-LMHMQ-GQPKN-MQHSPYYDD----------------------------LMTDINRFFQHHIERCVAAGIAK--N--K--LLLDPGFGFGKNLAHNYQLLAHLSELHH----------------FELPLLVGMSRKSMVGQLLNV------P-PQQRVIGSVACAVIAAMQGAQIIRVHDVKETVEAMCIVEATRSA-
22 PsiBlast_CBE 85.4534% -91 - C4 -3TZF ? B:[18-274] ----------------------------------------------------------------------------------------------------------------------PQVMGILNVTPDSFSDGGCHNNLD-QALQHAQRMLS-----AGATLIDIGGESTRPG--EVSEQEELDRVVPVV-----EAL--AQRFDVWLSVDTSKAAVITESAHAGAHLINDIRSLQE-PGALEAAAKTG-L-PVC-LMHMQ-GQPKN-MQHSPYYDD----------------------------LMTDINRFFQHHIERCVAAGIAK--N--K--LLLDPGFGFGKNLAHNYQLLAHLSELHH----------------FELPLLVGMSRKSMVGQLLNV------P-PQQRVIGSVACAVIAAMQGAQIIRVHDVKETVEAMCIVEATRSAK
52 PsiBlast_CBE 85.3731%-112 - C4 -3H2C ? B:[42-291] ------------------------------------------------------------------------------------------------------------------------IMGILNVTP-------SYNEVD-AAVRHAKEMRD-----EGAHIIDIGGES----------SVEEE-IKRVVPMIQAVSK--EVK--LPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVA-AHY-D-VPIILMHNR---------DNMNYRN----------------------------LMADMIADLYDSIK--IAKDAGV--R--DENIILDPGIGFAKTPEQNLEAMRNLEQLNV----------------LGYPVLLGTSRKSFIGHVLDL------P-VEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK-
4 PsiBlast_PDB 85.3133% -89 - C4 -1AJ0 DHPS_ECOLI A:[15-271] ----------------------------------------------------------------------------------------------------------------------PHVMGILNVTPDSFSDGGTHNS-LIDAVKHANLMIN-----AGATIIDVGGESTRPGAAEVSVEEELQRVIPVV-EAIAQRF----E--VWISVDTSKPEVIRESAKVGAHIINDIRSLSE-PGALEAA-AET-GLPVC-LMHMQ-GNPKT-MQEAPKYDD----------------------------VFAEVNRYFIEQIA--RCEQAGIAKE--K--LLLDPGFGFGKNLSHNYSLLARLAEFHH----------------FNLPLLVGMSRKSMIGQLLNV------G-PSERLSGSLACAVIAAMQGAHIIRVHDVKETVEAMRVVEATLSAK
49 PsiBlast_CBE 84.7531%-109 - C4 -3H2N ? A:[42-291] ------------------------------------------------------------------------------------------------------------------------IMGILNVTPDSF---GSYNEVD-AAVRHAKEMRD-----EGAHIIDIGGESTR-----V--SVEEE-IKRVVPMIQAVSK--EVK--LPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVA-AHY-D-VPIILMHNR---------DNMNYRN----------------------------LMADMIADLYDSIK--IAKDAGV--R--DENIILDPGIGFAKTPEQNLEAMRNLEQLNV----------------LGYPVLLGTSRKSFIGHVLDL------P-VEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK-
57 PsiBlast_CBE 84.6431%-108 * C4 *1TWZ ? B:[42-291] ------------------------------------------------------------------------------------------------------------------------IMGILNVTPD----GGSYNEVD-AAVRHAKEMRD-----EGAHIIDIGGES-------V--SVEEE-IKRVVPMIQAVSK--EVK--LPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVA-AHY-D-VPIILMHNR---------DNMNYRN----------------------------LMADMIADLYDSIK--IAKDAGV--R--DENIILDPGIGFAKTPEQNLEAMRNLEQLNV----------------LGYPVLLGTSRKSFIGHVLDL------P-VEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK-
45 PsiBlast_CBE 84.5031%-108 - C4 -3TYA ? B:[42-291] ------------------------------------------------------------------------------------------------------------------------IMGILNVTPD----GGSYNEVD-AAVRHAKEMRD-----EGAHIIDIGGES----------SVEEE-IKRVVPMIQAVSK--EVK--LPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVA-AHY-D-VPIILMHNR---------DNMNYRN----------------------------LMADMIADLYDSIK--IAKDAGV--R--DENIILDPGIGFAKTPEQNLEAMRNLEQLNV----------------LGYPVLLGTSRKSFIGHVLDL------P-VEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK-
2 PsiBlast_PDB 84.5034% -87 - C4 -3TYZ ? A:[18-274] ----------------------------------------------------------------------------------------------------------------------PQVMGILNVTPDSFSDGGCHNNLD-QALQHAQRMLS-----AGATLIDIGGESTRPGAAEVSEQEELDRVVPVV-----EAL--AQRFDVWLSVDTSKAAVITESAHAGAHLINDIRSLQE-PGALEAAAKTG-L-PVC-LMHMQ-GQPKN-MQHSPYYDD----------------------------LMTDINRFFQHHIERCVAAGIAK--N--K--LLLDPGFGFGKNLAHNYQLLAHLSELHH----------------FELPLLVGMSRKSMVGQLLNV------P-PQQRVIGSVACAVIAAMQGAQIIRVHDVKETVEAMCIVEATRSA-
53 PsiBlast_CBE 84.4531%-110 - C4 -3H2A ? B:[42-291] ------------------------------------------------------------------------------------------------------------------------IMGILNVTP-----GGSYNEVD-AAVRHAKEMRD-----EGAHIIDIGGEST------V--SVEEE-IKRVVPMIQAVSK--EVK--LPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVA-AHY-D-VPIILMHNR---------DNMNYRN----------------------------LMADMIADLYDSIK--IAKDAGV--R--DENIILDPGIGFAKTPEQNLEAMRNLEQLNV----------------LGYPVLLGTSRKSFIGHVLDL------P-VEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK-
46 PsiBlast_CBE 84.4431%-105 - C4 -3TYA ? A:[42-291] ------------------------------------------------------------------------------------------------------------------------IMGILNVTP-----GGSYNEVD-AAVRHAKEMRD-----EGAHIIDIGGEST----AKV--SVEEE-IKRVVPMIQAVSK--EVK--LPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVA-AHY-D-VPIILMHNR---------DNMNYRN----------------------------LMADMIADLYDSIK--IAKDAGV--R--DENIILDPGIGFAKTPEQNLEAMRNLEQLNV----------------LGYPVLLGTSRKSFIGHVLDL------P-VEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGKG
43 PsiBlast_CBE 84.3431%-104 - C4 -3TYB ? B:[42-291] ------------------------------------------------------------------------------------------------------------------------IMGILNVTPD----GGSYNEVD-AAVRHAKEMRD-----EGAHIIDIGGES----------SVEEE-IKRVVPMIQAVSK--EVK--LPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVA-AHY-D-VPIILMHNR---------DNMNYRN----------------------------LMADMIADLYDSIK--IAKDAGV--R--DENIILDPGIGFAKTPEQNLEAMRNLEQLNV----------------LGYPVLLGTSRKSFIGHVLDL------P-VEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK-
23 PsiBlast_CBE 84.0434% -88 - C4 -3TYZ ? B:[18-274] ----------------------------------------------------------------------------------------------------------------------PQVMGILNVTPDSFSDGGCHNNLD-QALQHAQRMLS-----AGATLIDIGGESTRPGAAEVSEQEELDRVVPVV-----EAL--AQRFDVWLSVDTSKAAVITESAHAGAHLINDIRSLQE-PGALEAAAKTG-L-PVC-LMHMQ-GQPKN-MQHSPYYDD----------------------------LMTDINRFFQHHIERCVAAGIAK--N--K--LLLDPGFGFGKNLAHNYQLLAHLSELHH----------------FELPLLVGMSRKSMVGQLLNV------P-PQQRVIGSVACAVIAAMQGAQIIRVHDVKETVEAMCIVEATRSAK
9 PsiBlast_PDB 83.9931%-106 - C4 -1TWZ ? A:[42-291] ------------------------------------------------------------------------------------------------------------------------IMGILNVTPDSFSDGGSYNEVD-AAVRHAKEMRD-----EGAHIIDIGGES-------V--SVEEE-IKRVVPMIQAVSK--EVK--LPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVA-AHY-D-VPIILMHNR---------DNMNYRN----------------------------LMADMIADLYDSIK--IAKDAGV--R--DENIILDPGIGFAKTPEQNLEAMRNLEQLNV----------------LGYPVLLGTSRKSFIGHVLDL------P-VEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK-
41 PsiBlast_CBE 83.8231%-111 - C4 -3TYD ? A:[42-291] ------------------------------------------------------------------------------------------------------------------------IMGILNVTPDSFS--GSYNEVD-AAVRHAKEMRD-----EGAHIIDIGGESTRPGFAKV--SVEEE-IKRVVPMIQAVSK--EVK--LPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVA-AHY-D-VPIILMHNR---------DNMNYRN----------------------------LMADMIADLYDSIK--IAKDAGV--R--DENIILDPGIGFAKTPEQNLEAMRNLEQLNV----------------LGYPVLLGTSRKSFIGHVLDL------P-VEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK-
34 PsiBlast_CBE 83.7431%-110 - C4 -4D9P ? B:[42-291] ------------------------------------------------------------------------------------------------------------------------IMGILNVT-----DGGSYNEVD-AAVRHAKEMRD-----EGAHIIDIGGES-------V--SVEEE-IKRVVPMIQAVSK--EVK--LPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVA-AHY-D-VPIILMHNR---------DNMNYRN----------------------------LMADMIADLYDSIK--IAKDAGV--R--DENIILDPGIGFAKTPEQNLEAMRNLEQLNV----------------LGYPVLLGTSRKSFIGHVLDL------P-VEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK-
44 PsiBlast_CBE 83.4131%-108 - C4 -3TYB ? A:[42-291] ------------------------------------------------------------------------------------------------------------------------IMGILNVTP---SDGGSYNEVD-AAVRHAKEMRD-----EGAHIIDIGGEST------V--SVEEE-IKRVVPMIQAVSK--EVK--LPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVA-AHY-D-VPIILMHNR---------DNMNYRN----------------------------LMADMIADLYDSIK--IAKDAGV--R--DENIILDPGIGFAKTPEQNLEAMRNLEQLNV----------------LGYPVLLGTSRKSFIGHVLDL------P-VEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK-
15 PsiBlast_PDB 83.2931%-103 - C4 -3H24 ? A:[42-291] ------------------------------------------------------------------------------------------------------------------------IMGILNVTPDSFSDGGSYNEVD-AAVRHAKEMRD-----EGAHIIDIGGEST------V--SVEEE-IKRVVPMIQAVSK--EVK--LPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVA-AHY-D-VPIILMHNR---------DNMNYRN----------------------------LMADMIADLYDSIK--IAKDAGV--R--DENIILDPGIGFAKTPEQNLEAMRNLEQLNV----------------LGYPVLLGTSRKSFIGHVLDL------P-VEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK-
10 PsiBlast_PDB 83.2931%-108 - C4 -1TX0 ? A:[42-291] ------------------------------------------------------------------------------------------------------------------------IMGILNVTPDSFSDGGSYNEVD-AAVRHAKEMRD-----EGAHIIDIGG--------KV--SVEEE-IKRVVPMIQAVSK--EVK--LPISIDTYKAEVAKQAIEAGAHIINDIWGAKAEPKIAEVA-AHY-D-VPIILMHNR---------DNMNYRN----------------------------LMADMIADLYDSIK--IAKDAGV--R--DENIILDPGIGFAKTPEQNLEAMRNLEQLNV----------------LGYPVLLGTSRKSFIGHVLDL------P-VEERLEGTGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGK-