@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : jhp_1266: (2015-12-22 )
MKLFDYAPLSLAWREFLQSEFKKPYFLEIEKRYLEALKSPKTIFPKSSNLFCAFNLTPPYAVKIILLGQDPYHSTYLENEQELPVAMGLSFSVEKNAPIPPSLKNIFKELHANLGVPVPCCGDLSAWAKRGMLLLNAILSVEKNQAASHKYIGWEAFSDQILIRLFETTTPLIVVLLGKVAQKKIALIPKNKHIIITAPHPSPLSRGFLGSGVFTSVQKAYREVYRKDFDFSL

Atome Classification :

(50 SA) .........10.......----.20---.........30........-40........50........60........70........80........90......-..100.......110...-....-.120.......130.......140.......-150........160.......-170.......180.......190.......200..--.--..--..210.......220.......230.----
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MKLFDYAPLSLAWREFLQ----SE----FKKPYFLEIEKRYLEALKS-PKTIFPKSSNLFCAFNLTPPYAVKIILLGQDPYHSTYLENEQELPVAMGLSFSVEKNA-PIPPSLKNIFKEL-HANL-GVPV-PCCGDLSAWAKRGMLLLNAILSVEKNQAASH-KY-IGWEAFSDQILIRLFETT-TPLIVVLLGKVAQKKIALIPKNKHIIITAPHPSPL--S--RG--FLGSGVFTSVQKAYREVYRKDFDFSL----
3 PsiBlast_PDB 93.7243%-120 - C8 -3ZOR - UNG_BACSU A:[5-211] --------LQDSWWNQLK----EE----FEKPYYQEL-REMLKREYA-EQTIYPDSRDIFNALHYTSYDDVKVVILGQDPYHGP--------GQAQGLSFSVKPGV-KQPPSLKNIFLEL-QQDI-GCSI-PNHGSLVSWAKQGVLLLNTVLTVRRGQANSH-KG-KGWERLTDRIIDVLSERE-RPVIFILWGRHAQMKKERIDTSKHFIIESTHPSPF--SARNG--FFGSRPFSRA-NAYLEKMGEAPIDWC----
78 Fugue 93.3639%-117 * C8 *1UUG - UNG_ECOLI A:[5-226] ----------LTWHDVLA----EE----KQQPYFLNTLQTVASERQS-GVTIYPPQKDVFNAFRFTELGDVKVVILGQDPYHGP--------GQAHGLAFSVRPGI-AIPPSLLNMYKEL-ENTIPGFTR-PNHGYLESWARQGVLLLNTVLTVRAGQAHSH-AS-LGWETFTDKVISLINQHR-EGVVFLLWGSHAQKKGAIIDKQRHHVLKAPHPSPLSAH--RG--FFGCNHFVLANQWLEQRGETPIDWMPVLPA
2 PsiBlast_PDB 93.0943%-122 - C8 -3ZOQ UNG_BACSU A:[5-211] --------LQDSWWNQLK----EE----FEKPYYQEL-REMLKREYA-EQTIYPDSRDIFNALHYTSYDDVKVVILGQDPYHGP--------GQAQGLSFSVKPGV-KQPPSLKNIFLEL-QQDI-GCSI-PNHGSLVSWAKQGVLLLNTVLTVRRGQANSH-KG-KGWERLTDRIIDVLSERE-RPVIFILWGRHAQMKKERIDTSKHFIIESTHPSPF--SARNG--FFGSRPFSRA-NAYLEKMGEAPIDWC----
32 PsiBlast_CBE 91.6338%-108 - C8 -2BOO UNG_DEIRA A:[21-240] ------ANLPEDWQEALL----PE----FSAPYFHELTD-FLRQERK-EYTIYPPAPDVFNALRYTPLGEVKVLILGQDPYHGP---NQ-----AHGLSFSVRPGV-RVPPSLRNIYKEL-TEDIPGFVA-PKHGYLRSWAEQGVLLLNAVLTVRAGQANSH-QG-KGWEHFTDAVIKAVNAKE-ERVVFILWGSYARKKKKLITGKNHVVIESGHPSPL--S--EQY-FFGTRPFSKTNEALEKAGRGPVEWQL----
64 HHSearch 91.3938%-112 - C8 -3FCI UNG_HUMAN A:[2-222] ------EFFGESWKKHLS----GE----FGKPYFIK-LMGFVAEERK-HYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPN--------QAHGLCFSVQRPV-PPPPSLENIYKEL-STDIEDFVH-PGHGDLSGWAKQGVLLLNAVLTVRAHQANSH-KE-RGWEQFTDAVVSWLNQNS-NGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPL--S--VYRGFFGCRHFSKTNELLQKSGKKPIDWKE----
33 PsiBlast_CBE 91.1438%-109 - C8 -3UFM UNG_DEIRA A:[21-240] ------ANLPEDWQEALL----PE----FSAPYFHELTD-FLRQERK-EYTIYPPAPDVFNALRYTPLGEVKVLILGQDPYHGP---NQ-----AHGLSFSVRPGV-RVPPSLRNIYKEL-TEDIPGFVA-PKHGYLRSWAEQGVLLLNAVLTVRAGQANSH-QG-KGWEHFTDAVIKAVNAKE-ERVVFILWGSYARKKKKLITGKNHVVIESGHPSPL--S--EQY-FFGTRPFSKTNEALEKAGRGPVEWQL----
62 HHSearch 91.0943%-101 - C8 -3TR7 - UNG_COXBU A:[7-224] ---------TQTWQTVLG----EE----KQEPYFQE-ILDFVKKERKAGKIIYPPQKDIFNALKLTPYEAIKVVILGQDPYHGPN--------QAHGLAFSVRPGV-PAPPSLQNIFKEL-HADL-GVSI-PSHGFLEKWAKQGVLLLNAALTVEAGKPQSH-AN-IGWHRFTDKVIESLNDHP-EGIVFLLWGSYAQKKSQLITNLRHRILKAPHPSPL--S--AARGFLGCRHFSKANQLLHEMGRGEIDWAL----
1 PsiBlast_PDB 90.8945%-101 - C8 -3TR7 - UNG_COXBU A:[14-224] ----------------LG----EE----KQEPYFQEILDFVKKERKA-GKIIYPPQKDIFNALKLTPYEAIKVVILGQDPYHGP---NQ-----AHGLAFSVRPGV-PAPPSLQNIFKEL-HADL-GVSI-PSHGFLEKWAKQGVLLLNAALTVEAGKPQSH-AN-IGWHRFTDKVIESLNDHP-EGIVFLLWGSYAQKKSQLITNLRHRILKAPHPSPL--SAARG--FLGCRHFSKANQLLHEMGRGEIDWAL----
4 PsiBlast_PDB 90.7139%-107 - C8 -3TKB UNG_HUMAN A:[7-220] -----------SWKKHLS----GE----FGKPYFIKLMGFVAEERKH--YTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGP---NQ-----AHGLCFSVQRPV-PPPPSLENIYKEL-STDIEGFVH-PGHGDLSGWAKQGVLLLNAVLTVRAHQANSH-KE-RGWEQFTDAVVSWLNQNS-NGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPL--SVYRG--FFGCRHFSKTNELLQKSGKKPIDWRE----
65 HHSearch 90.4238%-114 - C8 -3UF7 UNG_ECOLI A:[3-222] --------NELTWHDVLA----EE----KQQPYFLN-TLQTVASERQSGVTIYPPQKDVFNAFRFTELGDVKVVILGQDPYHGPG--------QAHGLAFSVRPGI-AIPPSLLNMYKEL-ENTIPGFTR-PNHGYLESWARQGVLLLNTVLTVRAGQAHSH-AS-LGWETFTDKVISLINQHR-EGVVFLLWGSHAQKKGAIIDKQRHHVLKAPHPSPL--S--AHRGFFGCNHFVLANQWLEQRGETPIDWMP----
31 PsiBlast_CBE 90.3639%-123 - C8 -3CXM ? A:[40-252] ------------WRDFLAPITADS----WRKGAFIRIERFLDEEKEK-GRVILPPAADIFNAFNSCPFRGLKVVLLGQDPYH--------DLHQAHGLCFSVLPEV-PLPPSLRNIYKEL-TTDIAGFQA-PKHGYLQSWSEQGMLMLNATLTVEAHKANSHSKT-SGWAAFTDAVIQHLSQHHPNRLVFLLWGGYAQQKKRLIDANRHVVLENVHPSPL--SANRG--WFGCRCFSACNEALQRMSHLPMHWQL----
19 PsiBlast_PDB 90.2639%-106 - C8 -1YUO - UNG_HUMAN A:[88-301] -----------SWKKHLS----GE----FGKPYFIKLMGFVAEERKH--YTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGP---NQ-----AHGLCFSVQRPV-PPPPSLVNIYKEL-STDI-EDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSH-KE-RGWEQFTDAVVSWLNQNS-NGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPL--SVYRG--FFGCRHFSKTNELLQKSGKKPIDWKE----
6 PsiBlast_PDB 90.2039%-103 - C8 -1SSP UNG_HUMAN E:[7-220] -----------SWKKHLS----GE----FGKPYFIKLMGFVAEERKH--YTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGP---NQ-----AHGLCFSVQRPV-PPPPSLENIYKEL-STDI-EDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSH-KE-RGWEQFTDAVVSWLNQNS-NGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPL--SVYRG--FFGCRHFSKTNELLQKSGKKPIDWKE----
7 PsiBlast_PDB 89.9639%-105 - C8 -1EMH UNG_HUMAN A:[7-220] -----------SWKKHLS----GE----FGKPYFIKLMGFVAEERKH--YTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGP---NQ-----AHGLCFSVQRPV-PPPPSLENIYKEL-STDI-EDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSH-KE-RGWEQFTDAVVSWLNQNS-NGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPL--SVYRG--FFGCRHFSKTNELLQKSGKKPIDWKE----
5 PsiBlast_PDB 89.7439%-107 - C8 -1UGH - UNG_HUMAN E:[88-301] -----------SWKKHLS----GE----FGKPYFIKLMGFVAEERKH--YTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGP---NQ-----AHGLCFSVQRPV-PPPPSLENIYKEL-STDI-EDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSH-KE-RGWEQFTDAVVSWLNQNS-NGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPL--SVYRG--FFGCRHFSKTNELLQKSGKKPIDWKE----
8 PsiBlast_PDB 89.6839%-104 - C8 -1EMJ UNG_HUMAN A:[7-220] -----------SWKKHLS----GE----FGKPYFIKLMGFVAEERKH--YTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGP---NQ-----AHGLCFSVQRPV-PPPPSLENIYKEL-STDI-EDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSH-KE-RGWEQFTDAVVSWLNQNS-NGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPL--SVYRG--FFGCRHFSKTNELLQKSGKKPIDWKE----
24 PsiBlast_CBE 89.6139%-101 - C8 -2SSP UNG_HUMAN E:[7-220] -----------SWKKHLS----GE----FGKPYFIKLMGFVAEERKH--YTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGP---NQ-----AHGLCFSVQRPV-PPPPSLENIYKEL-STDI-EDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSH-KE-RGWEQFTDAVVSWLNQNS-NGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPA--SVYRG--FFGCRHFSKTNELLQKSGKKPIDWKE----
21 PsiBlast_CBE 89.4339%-104 - C8 -3FCL UNG_HUMAN B:[7-220] -----------SWKKHLS----GE----FGKPYFIKLMGFVAEERKH--YTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGP---NQ-----AHGLCFSVQRPV-PPPPSLENIYKEL-STDI-EDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSH-KE-RGWEQFTDAVVSWLNQNS-NGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPL--SVYRG--FFGCRHFSKTNELLQKSGKKPIDWKE----
34 PsiBlast_CBE 89.2138%-103 - C8 -4UQM ? A:[21-240] ------ANLPEDWQEALL----PE----FSAPYFHELTD-FLRQERK-EYTIYPPAPDVFNALRYTPLGEVKVLILGQDPYHGP---NQ-----AHGLSFSVRPGV-RVPPSLRNIYKEL-TEDIPGFVA-PKHGYLRSWAEQGVLLLNAVLTVRAAQANSH-QG-KGWEHFTDAVIKAVNAKE-ERVVFILWGSYARKKKKLITGKNHVVIESGHPSPL--S--EQY-FFGTRPFSKTNEALEKAGRGPVEWQL----
17 PsiBlast_PDB 88.9539%-103 - C8 -3FCL UNG_HUMAN A:[7-220] -----------SWKKHLS----GE----FGKPYFIKLMGFVAEERKH--YTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGP---NQ-----AHGLCFSVQRPV-PPPPSLENIYKEL-STDI-EDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSH-KE-RGWEQFTDAVVSWLNQNS-NGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPL--SVYRG--FFGCRHFSKTNELLQKSGKKPIDWKE----
9 PsiBlast_PDB 88.9339%-103 - C8 -1Q3F UNG_HUMAN A:[7-220] -----------SWKKHLS----GE----FGKPYFIKLMGFVAEERKH--YTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGP---NQ-----AHGLCFSVQRPV-PPPPSLENIYKEL-STDI-EDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSH-KE-RGWEQFTDAVVSWLNQNS-NGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPL--SVYRG--FFGCRHFSKTNELLQKSGKKPIDWKE----
14 PsiBlast_PDB 88.9239%-104 - C8 -3FCF UNG_HUMAN A:[7-220] -----------SWKKHLS----GE----FGKPYFIKLMGFVAEERKH--YTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGP---NQ-----AHGLCFSVQRPV-PPPPSLENIYKEL-STDI-EDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSH-KE-RGWEQFTDAVVSWLNQNS-NGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPL--SVYRG--FFGCRHFSKTNELLQKSGKKPIDWKE----
16 PsiBlast_PDB 88.8839%-106 - C8 -3FCK UNG_HUMAN B:[7-220] -----------SWKKHLS----GE----FGKPYFIKLMGFVAEERKH--YTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGP---NQ-----AHGLCFSVQRPV-PPPPSLENIYKEL-STDI-EDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSH-KE-RGWEQFTDAVVSWLNQNS-NGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPL--SVYRG--FFGCRHFSKTNELLQKSGKKPIDWKE----
10 PsiBlast_PDB 88.8339%-104 - C8 -2HXM UNG_HUMAN A:[7-220] -----------SWKKHLS----GE----FGKPYFIKLMGFVAEERKH--YTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGP---NQ-----AHGLCFSVQRPV-PPPPSLENIYKEL-STDI-EDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSH-KE-RGWEQFTDAVVSWLNQNS-NGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPL--SVYRG--FFGCRHFSKTNELLQKSGKKPIDWKE----
12 PsiBlast_PDB 88.7639%-101 - C8 -2OXM UNG_HUMAN A:[7-220] -----------SWKKHLS----GE----FGKPYFIKLMGFVAEERKH--YTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGP---NQ-----AHGLCFSVQRPV-PPPPSLENIYKEL-STDI-EDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSH-KE-RGWEQFTDAVVSWLNQNS-NGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPL--SVYRG--FFGCRHFSKTNELLQKSGKKPIDWKE----
15 PsiBlast_PDB 88.5739%-107 - C8 -3FCI UNG_HUMAN A:[7-220] -----------SWKKHLS----GE----FGKPYFIKLMGFVAEERKH--YTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGP---NQ-----AHGLCFSVQRPV-PPPPSLENIYKEL-STDI-EDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSH-KE-RGWEQFTDAVVSWLNQNS-NGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPL--SVYRG--FFGCRHFSKTNELLQKSGKKPIDWKE----
23 PsiBlast_CBE 88.2942%-108 - C8 -1OKB ? A:[7-204] -----------TWRRELA----AE----FEKPYFKQL-MSFVADERS-RHTVYPPADQVYSWTEMCDIQDVKVVILGQDPYHGP---NQ-----AHGLCFSVQKPV-PPPPSLVNIYKEL-CTDIDGFKH-PGHGDLSGWAKQGVLLLNAVLTVRAHQANSH-KD-RGWETFTDAVIKWLSVNR-EGVVFLLWGSYAHKKGATIDRKRHHVLQAVHPSPL--SAHRG--FLGCKHFSKANGLLKLSGTEPINWRA----
66 HHSearch 88.1138%-110 - C8 -3CXM ? A:[33-261] -----GLITNPEWRDFLA----PITADSWRKGAFIR-IERFLDEEKEKGRVILPPAADIFNAFNSCPFRGLKVVLLGQDPYHDLH--------QAHGLCFSVLPEV-PLPPSLRNIYKEL-TTDIAGFQA-PKHGYLQSWSEQGMLMLNATLTVEAHKANSH-SKTSGWAAFTDAVIQHLSQHHPNRLVFLLWGGYAQQKKRLIDANRHVVLENVHPSPL--S--ANRGWFGCRCFSACNEALQRMSHLPMHWQL----
13 PsiBlast_PDB 87.6039%-102 - C8 -2OYT UNG_HUMAN A:[7-220] -----------SWKKHLS----GE----FGKPYFIKLMGFVAEERKH--YTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGP---NQ-----AHGLCFSVQRPV-PPPPSLENIYKEL-STDI-EDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSH-KE-RGWEQFTDAVVSWLNQNS-NGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPL--SVYRG--FFGCRHFSKTNELLQKSGKKPIDWKE----
29 PsiBlast_CBE 87.1539%-101 - C8 -4SKN UNG_HUMAN E:[7-220] -----------SWKKHLS----GE----FGKPYFIKLMGFVAEERKH--YTVYPPPHQVFTWTQMCDIKDVKVVILGQNPYHGP---NQ-----AHGLCFSVQRPV-PPPPSLENIYKEL-STDI-EDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSH-KE-RGWEQFTDAVVSWLNQNS-NGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPR--SVYRG--FFGCRHFSKTNELLQKSGKKPIDWKE----
22 PsiBlast_CBE 87.0142%-109 - C8 -1OKB ? B:[7-204] -----------TWRRELA----AE----FEKPYFKQL-MSFVADERS-RHTVYPPADQVYSWTEMCDIQDVKVVILGQDPYHGP---NQ-----AHGLCFSVQKPV-PPPPSLVNIYKEL-CTDIDGFKH-PGHGDLSGWAKQGVLLLNAVLTVRAHQANSH-KD-RGWETFTDAVIKWLSVNR-EGVVFLLWGSYAHKKGATIDRKRHHVLQAVHPSPL--SAHRG--FLGCKHFSKANGLLKLSGTEPINWRA----
45 PsiBlast_CBE 83.9337%-129 - C8 -4WS0 ? A:[51-237] -------------------------------------------------RRYLPAGSNVLRAFTF-PFDNVRVLIVGQDPYPTPGH--------AVGLSFSVAPDVRPWPRSLANIFDEY-TADL-GYPL-PSNGDLTPWAQRGVLLLNRVLTVRPSNPASH-RG-KGWEAVTECAIRALAARA-APLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSAS--RG--FFGSRPFSRANELLVGMGAEPIDWRL----
40 PsiBlast_CBE 83.9337%-134 - C8 -4WS5 ? A:[51-237] -------------------------------------------------RRYLPAGSNVLRAFTF-PFDNVRVLIVGQDPYPTPGH--------AVGLSFSVAPDVRPWPRSLANIFDEY-TADL-GYPL-PSNGDLTPWAQRGVLLLNRVLTVRPSNPASH-RG-KGWEAVTECAIRALAARA-APLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSAS--RG--FFGSRPFSRANELLVGMGAEPIDWRL----
51 PsiBlast_CBE 83.6637%-128 - C8 -4WRU ? A:[51-237] -------------------------------------------------RRYLPAGSNVLRAFTF-PFDNVRVLIVGQDPYPTPGH--------AVGLSFSVAPDVRPWPRSLANIFDEY-TADL-GYPL-PSNGDLTPWAQRGVLLLNRVLTVRPSNPASH-RG-KGWEAVTECAIRALAARA-APLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSAS--RG--FFGSRPFSRANELLVGMGAEPIDWRL----
55 PsiBlast_CBE 83.5631%-113 - C8 -1UDH UNG_HHV11 A:[31-234] -----------AWRPLME----PE----LANPLTAHLLAEYNRRCQT--EEVLPPREDVFSWTRYCTPDEVRVVIIGQDPYHHPGQ--------AHGLAFSVRANV-PPPPSLRNVLAAVKNCYP-EARM-SGHGCLEKWARDGVLLLNTTLTVKRGAAASH-SR-IGWDRFVGGVIRRLAARR-PGLVFMLWGTHAQNAIRPDPR-VHCVLKFSHPSPL--S--KV--PFGTCQHFLVANRYLETRSISPIDWS----
54 PsiBlast_CBE 82.9337%-126 - C8 -3A7N UNG_MYCTU A:[51-237] -------------------------------------------------RRYLPAGSNVLRAFTF-PFDNVRVLIVGQDPYPTPGH--------AVGLSFSVAPDVRPWPRSLANIFDEY-TADL-GYPL-PSNGDLTPWAQRGVLLLNRVLTVRPSNPASH-RG-KGWEAVTECAIRALAARA-APLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSAS--RG--FFGSRPFSRANELLVGMGAEPIDWRL----
38 PsiBlast_CBE 82.9237%-123 - C8 -4WS7 ? A:[51-237] -------------------------------------------------RRYLPAGSNVLRAFTF-PFDNVRVLIVGQDPYPTPGH--------AVGLSFSVAPDVRPWPRSLANIFDEY-TADL-GYPL-PSNGDLTPWAQRGVLLLNRVLTVRPSNPASH-RG-KGWEAVTECAIRALAARA-APLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSAS--RG--FFGSRPFSRANELLVGMGAEPIDWRL----
44 PsiBlast_CBE 82.8437%-126 - C8 -4WS1 ? A:[51-237] -------------------------------------------------RRYLPAGSNVLRAFTF-PFDNVRVLIVGQDPYPTPGH--------AVGLSFSVAPDVRPWPRSLANIFDEY-TADL-GYPL-PSNGDLTPWAQRGVLLLNRVLTVRPSNPASH-RG-KGWEAVTECAIRALAARA-APLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSAS--RG--FFGSRPFSRANELLVGMGAEPIDWRL----
49 PsiBlast_CBE 82.5537%-124 - C8 -4WRW ? A:[51-237] -------------------------------------------------RRYLPAGSNVLRAFTF-PFDNVRVLIVGQDPYPTPGH--------AVGLSFSVAPDVRPWPRSLANIFDEY-TADL-GYPL-PSNGDLTPWAQRGVLLLNRVLTVRPSNPASH-RG-KGWEAVTECAIRALAARA-APLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSAS--RG--FFGSRPFSRANELLVGMGAEPIDWRL----
37 PsiBlast_CBE 82.5037%-122 - C8 -4WS8 ? A:[51-237] -------------------------------------------------RRYLPAGSNVLRAFTF-PFDNVRVLIVGQDPYPTPGH--------AVGLSFSVAPDVRPWPRSLANIFDEY-TADL-GYPL-PSNGDLTPWAQRGVLLLNRVLTVRPSNPASH-RG-KGWEAVTECAIRALAARA-APLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSAS--RG--FFGSRPFSRANELLVGMGAEPIDWRL----
57 PsiBlast_CBE 82.4731%-117 - C8 -1LAU UNG_HHV11 E:[31-234] -----------AWRPLME----PE----LANPLTAHLLAEYNRRCQT--EEVLPPREDVFSWTRYCTPDEVRVVIIGQDPYHHPGQ--------AHGLAFSVRANV-PPPPSLRNVLAAVKNCYP-EARM-SGHGCLEKWARDGVLLLNTTLTVKRGAAASH-SR-IGWDRFVGGVIRRLAARR-PGLVFMLWGTHAQNAIRPDPR-VHCVLKFSHPSPL--S--KV--PFGTCQHFLVANRYLETRSISPIDWS----
47 PsiBlast_CBE 82.1837%-126 - C8 -4WRY ? A:[51-237] -------------------------------------------------RRYLPAGSNVLRAFTF-PFDNVRVLIVGQDPYPTPGH--------AVGLSFSVAPDVRPWPRSLANIFDEY-TADL-GYPL-PSNGDLTPWAQRGVLLLNRVLTVRPSNPASH-RG-KGWEAVTECAIRALAARA-APLVAILWGRDASTLKPMLAAGNCVAIESPHPSPLSAS--RG--FFGSRPFSRANELLVGMGAEPIDWRL----