@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Lmo0173: (2016-03-12 )
LEKERFRTELIGEKIGQLCKTYQFTYGYRKIAALMKQEEQVGINKVQRIMQKYQWQCQVKVKKKNRPGSAYYQTENHLNRNFQASQPLEKLTTDITYLYFGDCRLYLSSIMDLYNGEIVAYSIGEKQTQN

Atome Classification :

(20 SA) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------.........10........20.--.....------..30........----40-----.......----..50..---......60........70........80-----........90.....-----.-..100.......-..110--.......120...---....130----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LEKERFRTELIGEKIGQLCKTY--QFTYG------YRKIAALMKQEE----Q------VGINKVQ----RIMQKY---QWQCQVKVKKKNRPGSAYYQTENHLNRN-----FQASQPLEKLTTDIT-----Y-LYF--GDCRLYL-SSIMD--LYNGEIVAYSIGE---KQTQN------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
122 HHSearch 61.8218%-105 - C7 -1MZB FUR_PSEAE A:[20-70] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------RVKILQMLDSA--QRHMS------AEDVYKALME-A----GED----VGLATVY----RVLTQFEAAGLVV--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
130 Fugue 61.2621% -33 - C4 -4XFK ? A:[9-399] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------AEPLKIALVETLSGPQASTGLLYRAAVLYQLGKINEAGGFNGEKIQILEYDNQGGPVGAADRVKAAIADGAQIIVQGSSSAVAGQITEDVRKYNLRNKGKEVLYLNLGAEA--LELTGSK----CHFY--HFRFSPNAAIRFKTVAQGMKDKG----I------LG-ERAY----SINQNY---SWGVDVENTVVANAKEIGYEVVDKTLHE-----VNKIQDFSPYVAKIQAANVDT-VFT--GNWSNDL-LLLMK--AASGAGLKAKFATSFLDQPGNIGNAGAIAEGHIVSTPFNPEANGEASMAFAEDYKKVTGHYPSYVEPAAVFGLQLFGEALKNVKPGEGKINTTDIALAIENASVKTPMGDYSMRSDDHQAKFPMVVQEVSKKARIKADGTEYGFLPFKTFTGDESIDPVQESCSMKRPG--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
116 HHSearch 57.7615%-116 - C7 -2O03 ZUR_MYCTU A:[12-62] -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QRAAISTLLETL--DDFRS------AQELHDELRR-R----GEN----IGLTTVY----RTLQSMASSGLVD--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
120 HHSearch 57.4317% -83 * C10 *3JAM - ? N:[29-82] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SSDGVVEQIIKYARK-----GLT------PSQIGVLLRDAH----GVTQAKVITGNKIL----RILKSN---GLAP--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
114 HHSearch 57.2819%-118 - C10 -1K78 - PAX5_HUMAN A:[94-142] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------KVVEKIAEYKRQ---NPTMF------AWEIRDRLLAERVCDNDTV----PSVSSIN----RIIRTK---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
118 HHSearch 55.4915%-118 - C7 -3LAP ARGR_MYCTU A:[20-73] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GRQARIVAILSSA---QVRS------QNELAALLAA-E----GIE----VTQATLS----RDLEEL---GAVK--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
103 HHSearch 53.6615% -64 - C9 -3OYM POL_FOAMV A:[67-164] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------LAHTG------REATLLKIANLY----WWP----NMRKDVV----KQLGRC---QQ-CLITNASNKA--------SGPILRP-----DRPQKPFDKFFIDYI-----GPLPP--SQGYLYV-LVVVD--GMTGFTWLYPTKA---P----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
133 Fugue 53.2517% -12 - C1 -4GA6 AMPPA_THEKO A:[1-493] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------MKAKIRILDMFSGRYTVLINEEDAKEAKLHPDDLVKIEAGK--KAVYG------SVALSNLVGKG-----E------VGISRDV----LDLHNF---SEGETVSVIPAGTPESVRYIKKKMHGEK-----LR-KVEIEAIVRDIVDR---K-LRD--IEISSFV-TALEINGLDMDEIAALTIAM---AETGDMLDIDRKPIMDVHSIGGVPGNKTNILVVPIVAAAGLTIPKTSSRAITSAAGTADVVEVFADVSFSLDEIKRIVEKVGACLVWGGALNLAPADDITIKAERALSIDPTGLMLASIMSKKYAMGSQYVLIDIPTGKGVKVETVEEARSLARDFIELGKRLGQYVEVAITYGGQPIGHTVGPALEAREALSALMTGKGPGSLIEKATGLAGILLEMGGVAPAGTGKKMAKEILESGKAWEKMKEIIEAQGGDPNIKPEEIPIGDKTYTFTAATSGYVTAIDNRAITAIARAAGAPEDKGAGIELYVKVGEKVKEGDPLFTIHAEHEARLDQAIVLARRTEPIRIE
131 Fugue 51.8710% -20 - C2 -5DA0 ? A:[14-484] QREWFANPRKDVLAGIVVALALIPEAIAFSIIAGVDPQVGLYASFIIALITAFLGGRPGMISAATGAMALLMTGLVKDHGIQYLFAATVLTGVLQVVFGWAKLARYLKFVPRSVMVGFVNALAILIFMAQLPQFVGANWQMYAMVAAGLAIIYLLPLVFKAMPSALVAIVVLTVVAVVTGADVKTVGDMGTLPTALPHFQFPQVPLTFETLAIIFPVALTLSLVGLLESLLTAQLIDERTDTTSDKNVESRGQGVANIVTGFFGGMAGCAMIGQSMINVTSGGRGRLSTFVAGAFLMVLILALQPLLVQIPMAALVAVMMVVAISTFDWGSLRFPKGETVVMLATVAVTVFTH--DLSLG------VLIGVVLSALFF----A------RKVSQLS----QVTPVD---EVDGTRTYRVR---GQLFFVSTHDFLHQ-----FDFTHPARRVVIDLS-----D-AHFWDGSAVGAL-DKVML--KFMRQGTSVELRG---LNAASATLVERL-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
132 Fugue 51.2710% -20 - C3 -1A8Y - ? ?:[3-133] ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------GLDFPEYDGVDRVINVNA--KNY--KNVFK------KYEVLALLYHEP----P------EDDKASQ----RQFEME---ELILELAAQVLEDKGVGFGLVDSEKDAA-----VAKKLGLTE--EDSI-----Y-VFK--EDEVIEY-DGEFS-----ADTLVEFLLD---VLEDP------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
119 HHSearch 51.0822% -83 - C10 -3J7A - ? U:[29-83] -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------KPSEIEDAIIKLAKK-----GQT------PSQIGATLRDNY----GIPQVKSVTGNKIL----RILRAQ---GIATT-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
115 HHSearch 50.2213%-116 * C7 *1B4A - ARGR_GEOSE A:[5-54] ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QRHIKIREIIMS---NDIET------QDELVDRLRE-A----GFN----VTQATVS----RDIKEM---QLVKVP------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
127 Fugue 48.8717% -18 - C6 -4LTB - ? A:[2-172] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SLSQASADLEATLRHKLTVMYSQINGASRALDDVRNRQQDVRMTANRKVE--QLQQE------YTEMKALLDASE----T------TSTRKIKEEEKRVNSKF---DTIYQILLKKKSEIQTLKEEIEQSLTKRDEFEFLEKASKLRGISTKPV-----Y-I----PEVELNH-KLIKG--IHQSTIDLKNELK---QCIGRLQELTP------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
112 HHSearch 47.9813% -95 - C7 -2AHQ - ? A:[18-67] --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------QGELMKLIKEIVENEDKRKPYS------DQEIANILKE-K----GFK----VARRTVA----KYREML---G-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
95 PsiBlast_CBE 47.2036% -23 - C12 -1AMN ACES_TORCA A:[91-143] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SEDCLYLN-----IWVPSPRPKSTTVMV-----W-IYG--GG--FYSGSSTLD--VYNGKYLAYT-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
68 PsiBlast_CBE 46.9236% -26 - C12 -2ACE ACES_TORCA A:[91-143] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SEDCLYLN-----IWVPSPRPKSTTVMV-----W-IYG--GG--FYSGSSTLD--VYNGKYLAYT-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
94 PsiBlast_CBE 46.8536% -33 * C12 *1AX9 ACES_TORCA A:[91-143] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SEDCLYLN-----IWVPSPRPKSTTVMV-----W-IYG--GG--FYSGSSTLD--VYNGKYLAYT-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
97 PsiBlast_CBE 46.8436% -23 - C12 -1ACJ ACES_TORCA A:[91-142] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SEDCLYLN-----IWVPSPRPKSTTVMV-----W-IYG--GG--FYSGSSTLD--VYNGKYLAYT-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
30 PsiBlast_CBE 46.7836% -24 - C12 -2XI4 ACES_TORCA A:[91-140] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SEDCLYLN-----IWVPSPRPKSTTVMV-----W-IYG--GG--FYSGSSTLD--VYNGKYLAYT-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
69 PsiBlast_CBE 46.6436% -23 - C12 -1ZGC ACES_TORCA B:[91-142] ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------SEDCLYLN-----IWVPSPRPKSTTVMV-----W-IYG--GG--FYSGSSTLD--VYNGKYLAYT-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------