@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Lmo0210: (2016-03-13 )
MKDHQKIILVGDGAVGSSYAFACVNLSIGQEFGIIDIDKDRTIGDAMDLSHAVPFSTPKKIYSANYSDCHDADLVVVTAGTAQKPGETRLDLVNRNIKIMKGIVDEVMASGFDGIFLIASNPVDILTYATWKFSGLPKERVIGSGTSLDTARFRMSIADYLKVDARNVHGYILGEHGDTEFPAWSHTTVGGLPITEWISEDEQGAMDTIFVSVRDAAYEIINKKGATFYGVAAALARITKAILNNENAILPLSVYLDGHYGMNDIYIGAPAVVNRQGVRHIVEMNLNDKEKEQMKNSADTLKKVLDDAMKQID

Atome Classification :

(57 SA) ....-.....10........20........30........40........50.....-.-..-60..-.-....-.70........80........90........100.......110.......120.......130.......140.......150.......160......-.170.......180.......190.....-------.----.---200----.---..--....-----.210----.......220.......230.......240.......250.......260.......270.......280.......290.......300.......310.
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MKDH-QKIILVGDGAVGSSYAFACVNLSIGQEFGIIDIDKDRTIGDAMDLSHAVPFS-T-PK-KIYS-A-NYSD-CHDADLVVVTAGTAQKPGETRLDLVNRNIKIMKGIVDEVMASGFDGIFLIASNPVDILTYATWKFSGLPKERVIGSGTSLDTARFRMSIADYLKVDARNV-HGYILGEHGDTEFPAWSHTTVGGLPITEW-------I----S---ED-----E---QG--AMDT-----IFVS----VRDAAYEIINKKGATFYGVAAALARITKAILNNENAILPLSVYLDGHYGMNDIYIGAPAVVNRQGVRHIVEMNLNDKEKEQMKNSADTLKKVLDDAMKQID
32 PsiBlast_CBE 95.5567%-122 - C6 -2ZQY LDH_LACCA C:[10-321] -----QKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLSNALPFT-S-PK-KIYS-A-EYSD-AKDADLVVITAGAPQKPGETRLDLVNKNLKILKSIVDPIVDSGFNGIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAEMVNVDARSV-HAYIMGEHGDTEFPVWSHANIGGVTIAEW-------V----KAHPEI-----K---ED--KLVK-----MFED----VRDAAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKVLTDAFAKND
26 PsiBlast_CBE 95.3467%-122 - C6 -2ZQZ LDH_LACCA F:[7-318] -KDH-QKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLSNALPFT-S-PK-KIYS-A-EYSD-AKDADLVVITAGAPQKPGETRLDLVNKNLKILKSIVDPIVDSGFNGIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAEMVNVDARSV-HAYIMGEHGDTEFPVWSHANIGGVTIAEW-------V----KAHPEI-----K---ED--KLVK-----MFED----VRDAAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKVLTDAFA---
36 PsiBlast_CBE 95.2066%-121 - C6 -3VPF LDH_LACCA D:[7-317] -KDH-QKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLEDALPFT-S-PK-KIYS-A-EYSD-AKDADLVVITAGAPQKPGETRLDLVNKNLKILKSIVDPIVDSGFNGIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAKMVNVDARSV-HAYIMGEHGDTEFPVWSHANIGGVTIAEW-------V----KAHPEI-----K---ED--KLVK-----MFED----VRNKAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKVLTDAF----
39 PsiBlast_CBE 94.8866%-123 - C6 -3VKU LDH_LACCA F:[7-318] -KDH-QKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLEDALPFT-S-PK-KIYS-A-EYSD-AKDADLVVITAGAPQKPGETRLDLVNKNLKILKSIVDPIVDSGFNGIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAKMVNVDARSV-HAYIMGEHGDTEFPVWSHANIGGVTIAEW-------V----KAHPEI-----K---ED--KLVK-----MFED----VRNKAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKVLTDAFA---
40 PsiBlast_CBE 94.8666%-122 - C6 -3VKU LDH_LACCA E:[7-317] -KDH-QKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLEDALPFT-S-PK-KIYS-A-EYSD-AKDADLVVITAGAPQKPGETRLDLVNKNLKILKSIVDPIVDSGFNGIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAKMVNVDARSV-HAYIMGEHGDTEFPVWSHANIGGVTIAEW-------V----KAHPEI-----K---ED--KLVK-----MFED----VRNKAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKVLTDAF----
27 PsiBlast_CBE 94.5867%-120 - C6 -2ZQZ LDH_LACCA E:[7-317] -KDH-QKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLSNALPFT-S-PK-KIYS-A-EYSD-AKDADLVVITAGAPQKPGETRLDLVNKNLKILKSIVDPIVDSGFNGIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAEMVNVDARSV-HAYIMGEHGDTEFPVWSHANIGGVTIAEW-------V----KAHPEI-----K---ED--KLVK-----MFED----VRDAAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKVLTDAF----
23 PsiBlast_CBE 94.5567%-125 - C6 -3VKV LDH_LACCA D:[7-317] -KDH-QKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLSNALPFT-S-PK-KIYS-A-EYSD-AKDADLVVITAGAP-----TRLDLVNKNLKILKSIVDPIVDSGFNGIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAEMVNVDARSV-HAYIMGEHGDTEFPVWSHANIGGVTIAEW-------V----KAHPEI-----K---ED--KLVK-----MFED----VRDAAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKVLTDAF----
22 PsiBlast_CBE 94.4767%-122 - C6 -3VKV LDH_LACCA E:[7-317] -KDH-QKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLSNALPFT-S-PK-KIYS-A-EYSD-AKDADLVVITAGAPQKPGETRLDLVNKNLKILKSIVDPIVDSGFNGIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAEMVNVDARSV-HAYIMGEHGDTEFPVWSHANIGGVTIAEW-------V----KAHPEI-----K---ED--KLVK-----MFED----VRDAAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKVLTDAF----
28 PsiBlast_CBE 94.3067%-127 - C6 -2ZQZ LDH_LACCA D:[7-317] -KDH-QKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLSNALPFT-S-PK-KIYS-A-EYSD-AKDADLVVITAGAP-----TRLDLVNKNLKILKSIVDPIVDSGFNGIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAEMVNVDARSV-HAYIMGEHGDTEFPVWSHANIGGVTIAEW-------V----KAHPEI-----K---ED--KLVK-----MFED----VRDAAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKVLTDAF----
25 PsiBlast_CBE 93.9267%-124 - C6 -3VKV LDH_LACCA B:[7-318] -KDH-QKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLSNALPFT-S-PK-KIYS-A-EYSD-AKDADLVVITAGAPQKPGETRLDLVNKNLKILKSIVDPIVDSGFNGIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAEMVNVDARSV-HAYIMGEHGDTEFPVWSHANIGGVTIAEW-------V----KAHPEI-----K---ED--KLVK-----MFED----VRDAAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKVLTDAFA---
31 PsiBlast_CBE 93.8267%-126 - C6 -2ZQY LDH_LACCA D:[10-317] -----QKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLSNALPFT-S-PK-KIYS-A-EYSD-AKDADLVVITAGAP---GETRLDLVNKNLKILKSIVDPIVDSGFNGIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAEMVNVDARSV-HAYIMGEHGDTEFPVWSHANIGGVTIAEW-------V----KAHPEI-----K---ED--KLVK-----MFED----VRDAAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKVLTDAF----
21 PsiBlast_CBE 93.8067%-122 - C6 -3VKV LDH_LACCA F:[7-318] -KDH-QKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLSNALPFT-S-PK-KIYS-A-EYSD-AKDADLVVITAGAPQKPGETRLDLVNKNLKILKSIVDPIVDSGFNGIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAEMVNVDARSV-HAYIMGEHGDTEFPVWSHANIGGVTIAEW-------V----KAHPEI-----K---ED--KLVK-----MFED----VRDAAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKVLTDAFA---
1 PsiBlast_PDB 93.7867%-126 - C6 -2ZQY LDH_LACCA A:[10-317] -----QKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLSNALPFT-S-PK-KIYS-A-EYSD-AKDADLVVITAGAP---GETRLDLVNKNLKILKSIVDPIVDSGFNGIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAEMVNVDARSV-HAYIMGEHGDTEFPVWSHANIGGVTIAEW-------V----KAHPEI-----K---ED--KLVK-----MFED----VRDAAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKVLTDAF----
33 PsiBlast_CBE 93.7667%-125 - C6 -2ZQY LDH_LACCA B:[10-317] -----QKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLSNALPFT-S-PK-KIYS-A-EYSD-AKDADLVVITAGAPQKPGETRLDLVNKNLKILKSIVDPIVDSGFNGIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAEMVNVDARSV-HAYIMGEHGDTEFPVWSHANIGGVTIAEW-------V----KAHPEI-----K---ED--KLVK-----MFED----VRDAAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKVLTDAF----
35 PsiBlast_CBE 93.7366%-123 - C6 -3VPF LDH_LACCA E:[7-318] -KDH-QKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLEDALPFT-S-PK-KIYS-A-EYSD-AKDADLVVITAGAPQKPGETRLDLVNKNLKILKSIVDPIVDSGFNGIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAKMVNVDARSV-HAYIMGEHGDTEFPVWSHANIGGVTIAEW-------V----KAHPEI-----K---ED--KLVK-----MFED----VRNKAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKVLTDAFA---
43 PsiBlast_CBE 93.5966%-123 - C6 -3VKU LDH_LACCA B:[7-317] -KDH-QKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLEDALPFT-S-PK-KIYS-A-EYSD-AKDADLVVITAGAPQKPGETRLDLVNKNLKILKSIVDPIVDSGFNGIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAKMVNVDARSV-HAYIMGEHGDTEFPVWSHANIGGVTIAEW-------V----KAHPEI-----K---ED--KLVK-----MFED----VRNKAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKVLTDAF----
30 PsiBlast_CBE 93.4067%-121 - C6 -2ZQZ LDH_LACCA B:[7-318] -KDH-QKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLSNALPFT-S-PK-KIYS-A-EYSD-AKDADLVVITAGAPQKPGETRLDLVNKNLKILKSIVDPIVDSGFNGIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAEMVNVDARSV-HAYIMGEHGDTEFPVWSHANIGGVTIAEW-------V----KAHPEI-----K---ED--KLVK-----MFED----VRDAAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKVLTDAFA---
2 PsiBlast_PDB 93.4067%-124 - C6 -2ZQZ LDH_LACCA A:[7-317] -KDH-QKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLSNALPFT-S-PK-KIYS-A-EYSD-AKDADLVVITAGAP-----TRLDLVNKNLKILKSIVDPIVDSGFNGIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAEMVNVDARSV-HAYIMGEHGDTEFPVWSHANIGGVTIAEW-------V----KAHPEI-----K---ED--KLVK-----MFED----VRDAAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKVLTDAF----
37 PsiBlast_CBE 93.3166%-119 - C6 -3VPF LDH_LACCA C:[7-317] -KDH-QKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLEDALPFT-S-PK-KIYS-A-EYSD-AKDADLVVITAGAPQKPGETRLDLVNKNLKILKSIVDPIVDSGFNGIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAKMVNVDARSV-HAYIMGEHGDTEFPVWSHANIGGVTIAEW-------V----KAHPEI-----K---ED--KLVK-----MFED----VRNKAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKVLTDAF----
3 PsiBlast_PDB 92.9567%-128 - C6 -3VKV LDH_LACCA A:[7-317] -KDH-QKVILVGDGAVGSSYAYAMVLQGIAQEIGIVDIFKDKTKGDAIDLSNALPFT-S-PK-KIYS-A-EYSD-AKDADLVVITAGAP-----TRLDLVNKNLKILKSIVDPIVDSGFNGIFLVAANPVDILTYATWKLSGFPKNRVVGSGTSLDTARFRQSIAEMVNVDARSV-HAYIMGEHGDTEFPVWSHANIGGVTIAEW-------V----KAHPEI-----K---ED--KLVK-----MFED----VRDAAYEIIKLKGATFYGIATALARISKAILNDENAVLPLSVYMDGQYGLNDIYIGTPAVINRNGIQNILEIPLTDHEEESMQKSASQLKKVLTDAF----
53 PsiBlast_CBE 91.5958%-124 - C6 -1EZ4 LDH_LACPE B:[2-316] MPNH-QKVVLVGDGAVGSSYAFAMAQQGIAEEFVIVDVVKDRTKGDALDLEDAQAFT-A-PK-KIYS-G-EYSD-CKDADLVVITAGAPQKPGESRLDLVNKNLNILSSIVKPVVDSGFDGIFLVAANPVDILTYATWKFSGFPKERVIGSGTSLDSSRLRVALGKQFNVDPRSV-DAYIMGEHGDSEFAAYSTATIGTRPVRDV-------A----K----------E---QG--VSDD-----DLAKLEDGVRNKAYDIINLKGATFYGIGTALMRISKAILRDENAVLPVGAYMDGQYGLNDIYIGTPAIIGGTGLKQIIESPLSADELKKMQDSAATLKKVLNDGLAELE
51 PsiBlast_CBE 91.2158%-124 - C6 -1EZ4 LDH_LACPE D:[2-316] MPNH-QKVVLVGDGAVGSSYAFAMAQQGIAEEFVIVDVVKDRTKGDALDLEDAQAFT-A-PK-KIYS-G-EYSD-CKDADLVVITAGAPQKPGESRLDLVNKNLNILSSIVKPVVDSGFDGIFLVAANPVDILTYATWKFSGFPKERVIGSGTSLDSSRLRVALGKQFNVDPRSV-DAYIMGEHGDSEFAAYSTATIGTRPVRDV-------A----K----------E---QG--VSDD-----DLAKLEDGVRNKAYDIINLKGATFYGIGTALMRISKAILRDENAVLPVGAYMDGQYGLNDIYIGTPAIIGGTGLKQIIESPLSADELKKMQDSAATLKKVLNDGLAELE
8 PsiBlast_PDB 90.5158%-129 - C6 -1EZ4 LDH_LACPE A:[2-316] MPNH-QKVVLVGDGAVGSSYAFAMAQQGIAEEFVIVDVVKDRTKGDALDLEDAQAFT-A-PK-KIYS-G-EYSD-CKDADLVVITAGA----------LVNKNLNILSSIVKPVVDSGFDGIFLVAANPVDILTYATWKFSGFPKERVIGSGTSLDSSRLRVALGKQFNVDPRSV-DAYIMGEHGDSEFAAYSTATIGTRPVRDV-------A----K----------E---QG--VSDD-----DLAKLEDGVRNKAYDIINLKGATFYGIGTALMRISKAILRDENAVLPVGAYMDGQYGLNDIYIGTPAIIGGTGLKQIIESPLSADELKKMQDSAATLKKVLNDGLAELE
110 HHSearch 90.4758%-128 - C6 -1EZ4 LDH_LACPE A:[2-315] MPNH-QKVVLVGDGAVGSSYAFAMAQQGIAEEFVIVDVVKDRTKGDALDLEDAQAFT-A-PK-KIYS-G-EYSD-CKDADLVVITAGA----------LVNKNLNILSSIVKPVVDSGFDGIFLVAANPVDILTYATWKFSGFPKERVIGSGTSLDSSRLRVALGKQFNVDPRSV-DAYIMGEHGDSEFAAYSTATIGTRPVRDV-------A----K---EQGV---S---DD--DLAK-----LEDG----VRNKAYDIINLKGATFYGIGTALMRISKAILRDENAVLPVGAYMDGQYGLNDIYIGTPAIIGGTGLKQIIESPLSADELKKMQDSAATLKKVLNDGLAEL-
54 PsiBlast_CBE 90.4259%-125 - C6 -3PQF LDH_BACSU D:[3-310] --KHVNKVALIGAGFVGSSYAFALINQGITDELVVIDVNKEKAMGDVMDLNHGKAFAPQ-PV-KTSY-G-TYED-CKDADIVCICAGANQKPGETRLELVEKNLKIFKGIVSEVMASGFDGIFLVATNPVDILTYATWKFSGLPKERVIGSGTTLDSARFRFMLSEYFGAAPQNV-CAHIIGEHGDTELPVWSHANVGGVPVSEL-------V----E---KN-----DAYKQE--ELDQ-----IVDD----VKNAAYHIIEKKGATYYGVAMSLARITKAILHNENSILTVSTYLDGQYGADDVYIGVPAVVNRGGIAGITELNLNEKEKEQFLHSAGVLKNIL--------
13 PsiBlast_PDB 90.3258%-124 - C6 -3H3J LDH1_STAAC A:[8-313] ------KVVLIGNGAVGSSYAFSLVNQSIVDELVIIDLDTEKVRGDVMDLKHATPYSPT-TV-RVKA-G-EYSD-CHDADLVVICAGARQKPGETRLDLVSKNLKIFKSIVGEVMASKFDGIFLVATNPVDILAYATWKFSGLPKERVIGSGTILDSARFRLLLSEAFDVAPRSV-DAQIIGEHGDTELPVWSHANIAGQPLKTL-------L----E---QR-----P---EGKAQIEQ-----IFVQ----TRDAAYDIIQAKGATYYGVAMGLARITEAIFRNEDAVLTVSALLEGEYEEEDVYIGVPAVINRNGIRNVVEIPLNDEEQSKFAHSAKTLKDIMAEA-----
52 PsiBlast_CBE 90.1958%-128 - C6 -1EZ4 LDH_LACPE C:[2-316] MPNH-QKVVLVGDGAVGSSYAFAMAQQGIAEEFVIVDVVKDRTKGDALDLEDAQAFT-A-PK-KIYS-G-EYSD-CKDADLVVITAGA----------LVNKNLNILSSIVKPVVDSGFDGIFLVAANPVDILTYATWKFSGFPKERVIGSGTSLDSSRLRVALGKQFNVDPRSV-DAYIMGEHGDSEFAAYSTATIGTRPVRDV-------A----K----------E---QG--VSDD-----DLAKLEDGVRNKAYDIINLKGATFYGIGTALMRISKAILRDENAVLPVGAYMDGQYGLNDIYIGTPAIIGGTGLKQIIESPLSADELKKMQDSAATLKKVLNDGLAELE
12 PsiBlast_PDB 89.7558%-127 - C6 -3D4P LDH1_STAAC A:[8-312] ------KVVLIGNGAVGSSYAFSLVNQSIVDELVIIDLDTEKVRGDVMDLKHATPYSPT-TV-RVKA-G-EYSD-CHDADLVVICAGAAQKP--TRLDLVSKNLKIFKSIVGEVMASKFDGIFLVATNPVDILAYATWKFSGLPKERVIGSGTILDSARFRLLLSEAFDVAPRSV-DAQIIGEHGDTELPVWSHANIAGQPLKTL-------L----E---QR-----P---EGKAQIEQ-----IFVQ----TRDAAYDIIQAKGATYYGVAMGLARITEAIFRNEDAVLTVSALLEGEYEEEDVYIGVPAVINRNGIRNVVEIPLNDEEQSKFAHSAKTLKDIMAE------
57 PsiBlast_CBE 89.6058%-124 - C6 -3H3J LDH1_STAAC B:[8-313] ------KVVLIGNGAVGSSYAFSLVNQSIVDELVIIDLDTEKVRGDVMDLKHATPYSPT-TV-RVKA-G-EYSD-CHDADLVVICAGARQKPGETRLDLVSKNLKIFKSIVGEVMASKFDGIFLVATNPVDILAYATWKFSGLPKERVIGSGTILDSARFRLLLSEAFDVAPRSV-DAQIIGEHGDTELPVWSHANIAGQPLKTL-------L----E---QR-----P---EGKAQIEQ-----IFVQ----TRDAAYDIIQAKGATYYGVAMGLARITEAIFRNEDAVLTVSALLEGEYEEEDVYIGVPAVINRNGIRNVVEIPLNDEEQSKFAHSAKTLKDIMAEA-----
56 PsiBlast_CBE 88.8958%-124 - C6 -3D4P LDH1_STAAC B:[8-313] ------KVVLIGNGAVGSSYAFSLVNQSIVDELVIIDLDTEKVRGDVMDLKHATPYSPT-TV-RVKA-G-EYSD-CHDADLVVICAGAAQKPGETRLDLVSKNLKIFKSIVGEVMASKFDGIFLVATNPVDILAYATWKFSGLPKERVIGSGTILDSARFRLLLSEAFDVAPRSV-DAQIIGEHGDTELPVWSHANIAGQPLKTL-------L----E---QR-----P---EGKAQIEQ-----IFVQ----TRDAAYDIIQAKGATYYGVAMGLARITEAIFRNEDAVLTVSALLEGEYEEEDVYIGVPAVINRNGIRNVVEIPLNDEEQSKFAHSAKTLKDIMAEA-----
55 PsiBlast_CBE 88.8359%-124 - C6 -3PQF LDH_BACSU C:[3-310] --KHVNKVALIGAGFVGSSYAFALINQGITDELVVIDVNKEKAMGDVMDLNHGKAFAPQ-PV-KTSY-G-TYED-CKDADIVCICAGANQKPGETRLELVEKNLKIFKGIVSEVMASGFDGIFLVATNPVDILTYATWKFSGLPKERVIGSGTTLDSARFRFMLSEYFGAAPQNV-CAHIIGEHGDTELPVWSHANVGGVPVSEL-------V----E---KN-----DAYKQE--ELDQ-----IVDD----VKNAAYHIIEKKGATYYGVAMSLARITKAILHNENSILTVSTYLDGQYGADDVYIGVPAVVNRGGIAGITELNLNEKEKEQFLHSAGVLKNIL--------
17 PsiBlast_PDB 88.8256%-128 - C6 -4M1Q ? A:[29-331] ------RVVIIGTGAVGSSYAFSMINQNVTDEMVLIDLDKRKTEGDAMDLNHGIPFG-A-PT-KVWA-G-DYGD-CKSADIVVITAGAAQKPGETRLDLVEKNANIFKGIVDQVMGSGFNGIFIIATNPVDVLAYATWKFSGLPKERVIGSGTILDTARFRFLLSEYFDIDVRNI-HGYIMGEHGDTELPVWSQTRIGSEPISRY-------MDKYKP---DG-----S---NK--DLDE-----IFVN----VRDAAYHIIERKGATHYAIAMGLARLTKAILRNEQSILTVSTLMEGEYDLDDVYIGVPAIVSQKGVERAIEIDLNDEEMKKLHHSSNTLKDV---------