@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Sequence color : MutatedHelixStrandConserved

Query sequence : Lmo0226: (2016-03-13 )
MAKAFLSIGTNIGERLENLNDALRGLAASNQINITNVSSVYETDAVGYEDQAAFLNIAVEIETDFPPIDLLDFCLALELELGRVRLFKWGPRLIDIDVLLYDDVKTDTEKLKIPHPYMKERAFVMIPLIEISPEKSNLVENPALLEEQGVRKIKNQVNW

Atome Classification :

(45 SA) .........10........20........30........40........50..-----......60........70........80..-..-..-..90........100.......110.......120.......130..-----.....140.......150.......
(Atome) (Ident) (Tito) (Num) (Ligand) (Uniprot) MAKAFLSIGTNIGERLENLNDALRGLAASNQINITNVSSVYETDAVGYEDQAA-----FLNIAVEIETDFPPIDLLDFCLALELELGR-VR-LF-KWGPRLIDIDVLLYDDVKTDTEKLKIPHPYMKERAFVMIPLIEISPE-----KSNLVENPALLEEQGVRKIKNQVNW
101 Fugue 94.6638%-115 - C8 -1Q0N HPPK_ECOLI A:[1-158] -TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD-----YLNAAVALETSLAPEELLNHTQRIELQQGR-VRKAE-RWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW------
18 PsiBlast_PDB 91.7842%-132 - C8 -1Q0N HPPK_ECOLI A:[3-134] ---AYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD-----YLNAAVALETSLAPEELLNHTQRIELQQGR-VR-KAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPE------------------------------
29 PsiBlast_CBE 91.5542%-146 - C8 -3UDE HPPK_ECOLI A:[3-134] ---AYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD-----YLNAAVALETSLAPEELLNHTQRIELQQGR------ERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPE------------------------------
27 PsiBlast_CBE 91.1842%-137 - C8 -4F7V HPPK_ECOLI A:[3-134] ---AYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD-----YLNAAVALETSLAPEELLNHTQRIELQQGR-VR-KAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPE------------------------------
28 PsiBlast_CBE 90.5642%-143 - C8 -3UDV HPPK_ECOLI A:[3-134] ---AYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD-----YLNAAVALETSLAPEELLNHTQRIELQQGR------ERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPE------------------------------
51 PsiBlast_CBE 90.1641%-133 - C8 -3KUH HPPK_ECOLI A:[3-134] ---AYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD-----YLNAAVALETSLAPEELLNHTQRIELQQGR-VR-KAERWGPRTLDLDIMLFGNEVINTERLTVPAYDMKNRGFMLWPLFEIAPE------------------------------
48 PsiBlast_CBE 90.0841%-136 - C8 -1F9H HPPK_ECOLI A:[3-134] ---AYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD-----YLNAAVALETSLAPEELLNHTQRIELQQGR-VR-KAERWGPATLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPE------------------------------
4 PsiBlast_PDB 90.0447%-127 - C8 -4CRJ ? A:[4-140] MIQAYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAPVGYTEQPN-----FLNLCVEIQTTLTVLQLLECCLKTEECLHR-IR-KE-RWGPRTLDVDILLYGEEMIDLPKLSVPHPRMNERAFVLIPLNDIA--------ANVVE-------------------
22 PsiBlast_CBE 89.8647%-128 - C8 -4CYU ? C:[4-140] MIQAYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAPVGYTEQPN-----FLNLCVEIQTTLTVLQLLECCLKTEECLHR-IR-KE-RWGPRTLDVDILLYGEEMIDLPKLSVPHPRMNERAFVLIPLNDIA--------ANVVE-------------------
20 PsiBlast_PDB 89.8442%-135 - C8 -1RB0 HPPK_ECOLI A:[3-134] ---AYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD-----YLNAAVALETSLAPEELLNHTQRIELQQGR-VR-KAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPE------------------------------
5 PsiBlast_PDB 89.7947%-125 - C8 -4CWB ? A:[4-140] MIQAYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAPVGYTEQPN-----FLNLCVEIQTTLTVLQLLECCLKTEECLHR-IR-KE-RWGPRTLDVDILLYGEEMIDLPKLSVPHPRMNERAFVLIPLNDIA--------ANVVE-------------------
19 PsiBlast_PDB 89.7042%-146 - C8 -1RAO HPPK_ECOLI A:[3-134] ---AYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD-----YLNAAVALETSLAPEELLNHTQRIELQQGR-VR-KAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPE------------------------------
3 PsiBlast_PDB 89.3947%-119 - C8 -4AD6 ? A:[4-140] MIQAYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAPVGYTEQPN-----FLNLCVEIQTTLTVLQLLECCLKTEECLHR-IR-KE-RWGPRTLDVDILLYGEEMIDLPKLSVPHPRMNERAFVLIPLNDIA--------ANVVE-------------------
11 PsiBlast_PDB 89.3842%-129 - C8 -4M5L HPPK_ECOLI A:[4-138] MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD-----YLNAAVALETSLAPEELLNHTQRIELQQGR-VR-KAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPE------------------------------
46 PsiBlast_CBE 89.2741%-147 - C8 -1G4C HPPK_ECOLI B:[3-134] ---AYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD-----YLNAAVALETSLAPEELLNHTQRIELQQGR-VR-KAERWGPATLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPE------------------------------
49 PsiBlast_CBE 89.2241%-142 - C8 -3HT0 HPPK_ECOLI A:[3-134] ---AYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD-----YLNAAVALETSLAPEELLNHTQRIELQQGR-VR-KAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGAMLWPLFEIAPE------------------------------
8 PsiBlast_PDB 89.0142%-127 - C8 -4M5I HPPK_ECOLI A:[4-138] MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD-----YLNAAVALETSLAPEELLNHTQRIELQQGR-VR-KAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPE------------------------------
21 PsiBlast_CBE 88.9447%-124 - C8 -4CYU ? D:[4-140] MIQAYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAPVGYTEQPN-----FLNLCVEIQTTLTVLQLLECCLKTEECLHR-IR-KE-RWGPRTLDVDILLYGEEMIDLPKLSVPHPRMNERAFVLIPLNDIA--------ANVVE-------------------
12 PsiBlast_PDB 88.9142%-130 - C8 -4M5M HPPK_ECOLI A:[4-138] MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD-----YLNAAVALETSLAPEELLNHTQRIELQQGR-VR-KAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPE------------------------------
7 PsiBlast_PDB 88.8142%-125 - C8 -4M5H HPPK_ECOLI A:[4-138] MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD-----YLNAAVALETSLAPEELLNHTQRIELQQGR-VR-KAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPE------------------------------
30 PsiBlast_CBE 88.8042%-146 - C8 -3UD5 HPPK_ECOLI A:[3-134] ---AYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD-----YLNAAVALETSLAPEELLNHTQRIELQQGR-VR-KAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPE------------------------------
35 PsiBlast_CBE 88.6941%-143 - C8 -3HD2 HPPK_ECOLI A:[3-134] ---AYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDAPD-----YLNAAVALETSLAPEELLNHTQRIELQQGR-VR-KAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPE------------------------------
6 PsiBlast_PDB 88.5742%-127 - C8 -4M5G HPPK_ECOLI A:[4-138] MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD-----YLNAAVALETSLAPEELLNHTQRIELQQGR-VR-KAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPE------------------------------
32 PsiBlast_CBE 88.3942%-145 - C8 -3HSD HPPK_ECOLI B:[3-134] ---AYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD-----ALNAAVALETSLAPEELLNHTQRIELQQGR-VR-KAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPE------------------------------
24 PsiBlast_CBE 88.3947%-120 - C8 -4AD6 ? B:[4-140] MIQAYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAPVGYTEQPN-----FLNLCVEIQTTLTVLQLLECCLKTEECLHR-IR-KE-RWGPRTLDVDILLYGEEMIDLPKLSVPHPRMNERAFVLIPLNDIA--------ANVVE-------------------
9 PsiBlast_PDB 88.3942%-131 - C8 -4M5J HPPK_ECOLI A:[4-138] MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD-----YLNAAVALETSLAPEELLNHTQRIELQQGR-VR---ERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPE------------------------------
26 PsiBlast_CBE 88.3742%-124 - C8 -4M5N HPPK_ECOLI B:[4-138] MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD-----YLNAAVALETSLAPEELLNHTQRIELQQGR-VR-KAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPE------------------------------
2 PsiBlast_PDB 88.3247%-115 - C8 -3QBC ? A:[4-140] MIQAYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAPVGYTEQPN-----FLNLCVEIQTTLTVLQLLECCLKTEECLHR-IR-KE-RWGPRTLDVDILLYGEEMIDLPKLSVPHPRMNERAFVLIPLNDIA--------ANVVE-------------------
25 PsiBlast_CBE 88.1747%-123 - C8 -3QBC ? B:[4-140] MIQAYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAPVGYTEQPN-----FLNLCVEIQTTLTVLQLLECCLKTEECLHR-IR-KE-RWGPRTLDVDILLYGEEMIDLPKLSVPHPRMNERAFVLIPLNDIA--------ANVVE-------------------
10 PsiBlast_PDB 88.0642%-127 - C8 -4M5K HPPK_ECOLI A:[4-138] MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD-----YLNAAVALETSLAPEELLNHTQRIELQQGR-VR-KAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPE------------------------------
23 PsiBlast_CBE 88.0447%-124 - C8 -4CYU ? B:[4-140] MIQAYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETAP---TEQPN-----FLNLCVEIQTTLTVLQLLECCLKTEECLHR-IR-KE-RWGPRTLDVDILLYGEEMIDLPKLSVPHPRMNERAFVLIPLNDIA--------ANVVE-------------------
13 PsiBlast_PDB 88.0042%-125 - C8 -4M5N HPPK_ECOLI A:[4-138] MTVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD-----YLNAAVALETSLAPEELLNHTQRIELQQGR-VR-KAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPE------------------------------
45 PsiBlast_CBE 87.8541%-131 - C8 -1HQ2 HPPK_ECOLI A:[3-134] ---AYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD-----YLNAAVALETSLAPEELLNHTQRIELQQGA-VR-KAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPE------------------------------
33 PsiBlast_CBE 87.7942%-135 - C8 -3HSD HPPK_ECOLI A:[3-134] ---AYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD-----ALNAAVALETSLAPEELLNHTQRIELQQGR-VR-KAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPE------------------------------
14 PsiBlast_PDB 87.6342%-129 - C8 -1DY3 HPPK_ECOLI A:[3-134] ---AYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD-----YLNAAVALETSLAPEELLNHTQRIELQQGR-VR-KAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPE------------------------------
16 PsiBlast_PDB 87.3542%-138 - C8 -1EQM HPPK_ECOLI A:[3-134] ---AYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD-----YLNAAVALETSLAPEELLNHTQRIELQQGR-VR-KAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPE------------------------------
40 PsiBlast_CBE 87.2841%-143 - C8 -3HSJ HPPK_ECOLI A:[3-134] ---AYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD-----YLAAAVALETSLAPEELLNHTQRIELQQGR-VR-KAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPE------------------------------
50 PsiBlast_CBE 87.0641%-136 - C8 -3HSZ HPPK_ECOLI A:[3-134] ---AYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD-----YLNAAVALETSLAPEELLNHTQRIELQQGR-VR-KAERWGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGAMLWPLFEIAPE------------------------------
58 PsiBlast_CBE 87.0540%-158 - C8 -1RU2 HPPK_ECOLI A:[3-128] ---AYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPP------PD-----YLNAAVALETSLAPEELLNHTQRIELQQGR--------GGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPE------------------------------
1 PsiBlast_PDB 86.3247%-128 - C8 -4CYU ? A:[4-140] MIQAYLGLGSNIGDRESQLNDAIKILNEYDGISVSNISPIYETA----TEQPN-----FLNLCVEIQTTLTVLQLLECCLKTEECLHR-IR-KE-RWGPRTLDVDILLYGEEMIDLPKLSVPHPRMNERAFVLIPLNDIA--------ANVVE-------------------
61 PsiBlast_CBE 85.1840%-140 - C8 -1RTZ HPPK_ECOLI A:[3-128] ---AYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPD-----YLNAAVALETSLAPEELLNHTQRIELQQGR--------GGPRTLDLDIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPE------------------------------
62 PsiBlast_CBE 84.1838%-138 - C8 -4PZV ? A:[4-145] ----IIGIGTNIGFTIENIHLAITALESQQNIRIIRKASLYSSKAVLKEDAPKEWDIRFLNTAVKISSSLKPDELLVLLKDIELKIGRDLN-AP-AWSPRVIDLDILAAEDLILETDKLTIPHKELINRSFALAPLLELS--------------------------------
64 PsiBlast_CBE 83.2436%-139 - C8 -3MCO ? A:[21-181] MVQYIIGIGTNSGFTIENIHLAITALESQQNIRIIRKASLYSSKAVLK--APKEWDIRFLNTAVKISSSLKPDELLVLLKDIELKIGRDLN-AP-AWSPRVIDLDILAAEDLILETDKLTIPHKELINRSFALAPLLELS--------------------------------